StarFunc result for job id O14607

User Input

>input (1347 residues)
MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLH
EDGARTKTLLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQ
ADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDY
KSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLPAQVKA
TVLQQLGWMHHNMDLVGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDA
FISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYE
SCNQPQDAIKCYLNAARSKRCSNTSTLAARIKFLQNGSDNWNGGQSLSHHPVQQVYSLCL
TPQKLQHLEQLRANRDNLNPAQKHQLEQLESQFVLMQQMRHKEVAQVRTTGIHNGAITDS
SLPTNSVSNRQPHGALTRVSSVSQPGVRPACVEKLLSSGAFSAGCIPCGTSKILGSTDTI
LLGSNCIAGSESNGNVPYLQQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCL
SGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATSGGQQG
IMFTKESKPSKNRSLVPETSRHTGDTSNGCADVKGLSNHVHQLIADAVSSPNHGDSPNLL
IADNPQLSALLIGKANGNVGTGTCDKVNNIHPAVHTKTDHSVASSPSSAISTATPSPKST
EQRSINSVTSLNSPHSGLHTVNGEGLGKSQSSTKVDLPLASHRSTSQILPSMSVSICPSS
TEVLKACRNPGKNGLSNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFF
PPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWD
PTGTKKIWRCESNRSHTTIAKYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGR
RRKGPFKTIKFGTNIDLSDNKKWKLQLHELTKLPAFARVVSAGNLLTHVGHTILGMNTVQ
LYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSW
WPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLTACQYKLAV
ERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAA
GKEVIWHGRTNDEPAHYCSICEVEVFNLLFVTNESNTQKTYIVHCHDCARKTSKSLENFV
VLEQYKMEDLIQVYDQFTLALSLSSSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K6D0	0.615	0.607	0.000	1366	0.826	0.814	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
2	AFDB:A1L1S9	0.673	0.690	0.000	1311	0.592	0.609	A1L1S9.pdb.gz	A1L1S9_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=utxl1 PE=2 SV=1
3	AFDB:O14607	1.000	1.000	0.000	1347	1.000	1.000	O14607.pdb.gz	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
4	AFDB:O15550	0.572	0.552	0.000	1401	0.862	0.829	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
5	AFDB:P79457	0.369	0.409	0.000	1212	0.691	0.768	P79457.pdb.gz	UTY_MOUSE Histone demethylase UTY OS=Mus musculus OX=10090 GN=Uty PE=1 SV=2
6	AFDB:Q9VL07	0.358	0.423	1.394E-87	1136	0.390	0.462	Q9VL07.pdb.gz	Q9VL07_DROME LD02225p OS=Drosophila melanogaster OX=7227 GN=Utx PE=2 SV=3
7	AFDB:Q5ADP3	0.215	0.266	1.075E-22	1080	0.149	0.186	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
8	PDB:7ntfA	0.168	0.231	3.511E-10	918	0.050	0.074	7ntfA.pdb.gz
9	PDB:7qe7U	0.123	0.263	2.552E-9	540	0.059	0.146	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
10	AFDB:F4HS99	0.132	0.101	7.161E-9	1797	0.079	0.059	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
11	PDB:4bujB	0.186	0.183	2.314E-8	1367	0.045	0.044	4bujB.pdb.gz
12	AFDB:F4HZK4	0.129	0.110	3.350E-8	1608	0.092	0.077	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
13	PDB:4horA	0.166	0.375	3.595E-8	482	0.046	0.129	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
14	PDB:5udkA	0.167	0.395	4.482E-8	461	0.049	0.143	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
15	PDB:6xt9D	0.189	0.544	5.839E-8	396	0.040	0.136	6xt9D.pdb.gz
16	PDB:7qdrB	0.203	0.223	6.665E-8	1212	0.055	0.061	7qdrB.pdb.gz
17	PDB:5dseA	0.188	0.411	7.279E-8	537	0.048	0.121	5dseA.pdb.gz
18	PDB:2y4uA	0.114	0.283	8.683E-8	424	0.042	0.134	2y4uA.pdb.gz
19	PDB:5g05F	0.149	0.329	9.074E-8	460	0.054	0.159	5g05F.pdb.gz	Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
20	AFDB:F4JKH6	0.158	0.120	1.638E-7	1819	0.098	0.073	F4JKH6.pdb.gz	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6D0	2058	1316	0.781	0.799	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
2	A0A8I5ZM74	2315	1400	0.854	0.821	A0A8I5ZM74_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
3	A0A8I5ZTM6	1076	1208	0.423	0.472	A0A8I5ZTM6_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
4	A0A8I5ZXR3	1718	1418	0.692	0.657	A0A8I5ZXR3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
5	A0A8I6A5T3	1786	1452	0.713	0.662	A0A8I6A5T3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
6	A0A8I6ADI5	2264	1321	0.832	0.849	A0A8I6ADI5_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
7	A0A8I6AFH2	704	1635	0.238	0.196	A0A8I6AFH2_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=1
8	A0A8I6G9K0	1084	1150	0.428	0.501	A0A8I6G9K0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
9	A0A8I6GMA3	2242	1373	0.832	0.816	A0A8I6GMA3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=1
10	A0A8I6GMK8	1085	1214	0.428	0.474	A0A8I6GMK8_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
11	A1L1S9	1507	1311	0.621	0.638	A1L1S9_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=utxl1 PE=2 SV=1
12	C9WPN3	701	1134	0.255	0.303	C9WPN3_RAT [histone H3]-trimethyl-L-lysine(27) demethylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Uty PE=2 SV=1
13	F1Q597	1684	1452	0.690	0.640	F1Q597_DANRE [histone H3]-trimethyl-L-lysine(27) demethylase OS=Danio rerio OX=7955 GN=kdm6a PE=1 SV=2
14	G3V9U4	704	1569	0.238	0.205	G3V9U4_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=4
15	M9MRG4	637	1130	0.220	0.263	M9MRG4_DROME Utx histone demethylase, isoform D OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
16	M9PCJ7	637	934	0.220	0.318	M9PCJ7_DROME Utx histone demethylase, isoform E OS=Drosophila melanogaster OX=7227 GN=Utx PE=3 SV=1
17	O14607	2817	1347	1.000	1.000	UTY_HUMAN Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2
18	O15054	702	1643	0.238	0.195	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
19	O15550	2341	1401	0.866	0.832	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
20	O70546	2313	1401	0.857	0.824	KDM6A_MOUSE Lysine-specific demethylase 6A OS=Mus musculus OX=10090 GN=Kdm6a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02373 JmjC	8.5e-29	111.7	JmjC domain, hydroxylase
2	PF00515 TPR_1	8.2e-23	90.4	Tetratricopeptide repeat
3	PF13414 TPR_11	2	19.5	TPR repeat
4	PF13424 TPR_12	6.6e-06	37.7	Tetratricopeptide repeat
5	PF13428 TPR_14	0.003	29.2	Tetratricopeptide repeat
6	PF13429 TPR_15	4.3e+02	11.6	Tetratricopeptide repeat
7	PF13432 TPR_16	4.3e-11	54.5	Tetratricopeptide repeat
8	PF13431 TPR_17	2.6e-07	41.6	Tetratricopeptide repeat
9	PF14559 TPR_19	0.00027	32.7	Tetratricopeptide repeat
10	PF07719 TPR_2	2.6e-12	56.9	Tetratricopeptide repeat
11	PF13174 TPR_6	3.7e+02	13.2	Tetratricopeptide repeat
12	PF13176 TPR_7	0.005	27.8	Tetratricopeptide repeat
13	PF13181 TPR_8	9e-11	52.1	Tetratricopeptide repeat
14	PF13371 TPR_9	0.05	25.0	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000014329

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010723	0.962	RB binding protein 5, histone lysine methyltransferase complex subunit
2	60711.ENSCSAP00000002818	0.944	PAX interacting (with transcription-activation domain) protein 1
3	60711.ENSCSAP00000011584	0.935	ASH2 like histone lysine methyltransferase complex subunit
4	60711.ENSCSAP00000002475	0.934	Histone-lysine N-methyltransferase
5	60711.ENSCSAP00000011668	0.922	WD repeat domain 5
6	60711.ENSCSAP00000002864	0.910	Histone-lysine N-methyltransferase
7	60711.ENSCSAP00000000608	0.896	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
8	60711.ENSCSAP00000004530	0.894	Mediator of DNA-damage checkpoint 1
9	60711.ENSCSAP00000008166	0.892	Nuclear receptor coactivator 6
10	60711.ENSCSAP00000017790	0.860	Belongs to the histone H3 family.
11	60711.ENSCSAP00000000026	0.854	Embryonic ectoderm development
12	60711.ENSCSAP00000003315	0.853	Enhancer of zeste 2 polycomb repressive complex 2 subunit
13	60711.ENSCSAP00000009732	0.850	WD repeat domain 38
14	60711.ENSCSAP00000009603	0.837	ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
15	60711.ENSCSAP00000002874	0.829	SUZ12 polycomb repressive complex 2 subunit
16	60711.ENSCSAP00000013987	0.827	Produces ATP from ADP in the presence of a proton gradient across the membrane
17	60711.ENSCSAP00000002114	0.823	F-box and leucine-rich repeat protein 19
18	60711.ENSCSAP00000000728	0.821	Histone-lysine N-methyltransferase
19	60711.ENSCSAP00000019021	0.816	Uncharacterized protein
20	60711.ENSCSAP00000008442	0.814	ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0032452	0.999	histone demethylase activity
GO:0005515	0.927	protein binding
GO:0003682	0.918	chromatin binding
GO:1901363	0.647	heterocyclic compound binding
GO:0097159	0.647	organic cyclic compound binding
GO:0003676	0.644	nucleic acid binding
GO:0003677	0.619	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071496	0.986	cellular response to external stimulus
GO:0071704	0.985	organic substance metabolic process
GO:0009991	0.985	response to extracellular stimulus
GO:0044238	0.984	primary metabolic process
GO:0009719	0.982	response to endogenous stimulus
GO:0048583	0.981	regulation of response to stimulus
GO:0006807	0.980	nitrogen compound metabolic process
GO:0051716	0.976	cellular response to stimulus
GO:0016043	0.976	cellular component organization
GO:0010468	0.976	regulation of gene expression
GO:0048519	0.974	negative regulation of biological process
GO:0070887	0.972	cellular response to chemical stimulus
GO:0043170	0.971	macromolecule metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:1901564	0.968	organonitrogen compound metabolic process
GO:0070988	0.967	demethylation
GO:0080090	0.967	regulation of primary metabolic process
GO:0031670	0.960	cellular response to nutrient
GO:0033273	0.958	response to vitamin
GO:0031326	0.957	regulation of cellular biosynthetic process
GO:0010556	0.955	regulation of macromolecule biosynthetic process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:0036211	0.955	protein modification process
GO:1990776	0.953	response to angiotensin
GO:0071295	0.953	cellular response to vitamin
GO:0071559	0.951	response to transforming growth factor beta
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0016570	0.946	histone modification
GO:1904385	0.937	cellular response to angiotensin
GO:0048522	0.932	positive regulation of cellular process
GO:0071560	0.920	cellular response to transforming growth factor beta stimulus
GO:2001243	0.916	negative regulation of intrinsic apoptotic signaling pathway
GO:0045935	0.901	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.899	positive regulation of macromolecule metabolic process
GO:0009891	0.891	positive regulation of biosynthetic process
GO:0033280	0.889	response to vitamin D
GO:0031328	0.872	positive regulation of cellular biosynthetic process
GO:0006357	0.871	regulation of transcription by RNA polymerase II
GO:0051254	0.869	positive regulation of RNA metabolic process
GO:0070482	0.840	response to oxygen levels
GO:0045944	0.817	positive regulation of transcription by RNA polymerase II
GO:0006950	0.744	response to stress
GO:0044237	0.731	cellular metabolic process
GO:0033554	0.715	cellular response to stress
GO:0090066	0.616	regulation of anatomical structure size
GO:0071453	0.613	cellular response to oxygen levels
GO:0008361	0.581	regulation of cell size
GO:0071456	0.563	cellular response to hypoxia
GO:0080135	0.561	regulation of cellular response to stress
GO:0071407	0.561	cellular response to organic cyclic compound
GO:0032501	0.527	multicellular organismal process
GO:0071396	0.517	cellular response to lipid
GO:0032502	0.477	developmental process
GO:0006325	0.467	chromatin organization
GO:0048856	0.427	anatomical structure development
GO:0007275	0.354	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.978	protein-containing complex
GO:1902494	0.737	catalytic complex
GO:1990234	0.505	transferase complex
GO:0043232	0.429	intracellular non-membrane-bounded organelle
GO:0035097	0.425	histone methyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]