StarFunc result for job id O14617

User Input

>input (1153 residues)
MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVC
KLTYLQMLGYDISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKDL
SSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPES
LRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIK
IIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSAS
IQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRA
LDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQYITNFEWYIS
ILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICE
VLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQA
GEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALF
AGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEA
DEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVEHIPVVQIDLSVPLKVPGLPM
SDQYVKLEEERRHRQKLEKDKRRKKRKEKEKKGKRRHSSLPTESDEDIAPAQQVDIVTEE
MPENALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPIQKHRNTETSKSPEKDVPMVEKK
SKKPKKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQPPGSEE
AAGEPVQNGAPEEEQLPPESSYSLLAENSYVKMTCDIRGSLQEDSQVTVAIVLENRSSSI
LKGMELSVLDSLNARMARPQGSSVHDGVPVPFQLPPGVSNEAQYVFTIQSIVMAQKLKGT
LSFIAKNDEGATHEKLDFRLHFSCSSYLITTPCYSDAFAKLLESGDLSMSSIKVDGIRMS
FQNLLAKICFHHHFSVVERVDSCASMYSRSIQGHHVCLLVKKGENSVSVDGKCSDSTLLS
NLLEEMKATLAKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DFK6	0.569	0.547	0.000	1204	0.902	0.864	B5DFK6.pdb.gz	B5DFK6_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
2	AFDB:O14617	1.000	1.000	0.000	1153	1.000	1.000	O14617.pdb.gz	AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1
3	AFDB:P54362	0.566	0.628	3.041E-63	1034	0.467	0.520	P54362.pdb.gz	AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster OX=7227 GN=g PE=1 SV=4
4	AFDB:Q9UTL8	0.516	0.716	1.242E-39	825	0.258	0.360	Q9UTL8.pdb.gz	AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl5 PE=3 SV=2
5	AFDB:Q9C744	0.498	0.649	1.392E-36	869	0.235	0.312	Q9C744.pdb.gz	AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana OX=3702 GN=DELTA-ADR PE=1 SV=1
6	AFDB:Q9UPM8	0.374	0.378	8.121E-34	1137	0.186	0.189	Q9UPM8.pdb.gz	AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens OX=9606 GN=AP4E1 PE=1 SV=2
7	AFDB:Q80V94	0.366	0.375	2.769E-31	1122	0.173	0.178	Q80V94.pdb.gz	AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus OX=10090 GN=Ap4e1 PE=1 SV=3
8	AFDB:Q8I8U2	0.448	0.562	3.901E-26	895	0.147	0.190	Q8I8U2.pdb.gz	AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum OX=44689 GN=ap1g1 PE=1 SV=1
9	AFDB:Q84K16	0.429	0.550	1.742E-25	876	0.150	0.197	Q84K16.pdb.gz	AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA-ADR PE=1 SV=1
10	AFDB:Q7KVR8	0.464	0.536	1.954E-25	982	0.150	0.176	Q7KVR8.pdb.gz	Q7KVR8_DROME AP-1 complex subunit gamma OS=Drosophila melanogaster OX=7227 GN=AP-1gamma PE=1 SV=1
11	PDB:7p3xA	0.422	0.801	2.378E-22	576	0.160	0.319	7p3xA.pdb.gz
12	PDB:5a1uE	0.330	0.437	2.367E-13	824	0.112	0.157	5a1uE.pdb.gz
13	PDB:5nzrG	0.328	0.446	1.278E-8	798	0.108	0.157	5nzrG.pdb.gz
14	PDB:1b3uA	0.229	0.390	4.197E-8	588	0.079	0.155	1b3uA.pdb.gz
15	PDB:7p3xB	0.281	0.456	5.928E-8	621	0.077	0.143	7p3xB.pdb.gz
16	PDB:6yafB	0.328	0.593	8.701E-8	579	0.093	0.185	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
17	PDB:4jlqA	0.243	0.315	3.086E-7	840	0.075	0.104	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:7cunG	0.281	0.342	3.332E-7	895	0.093	0.120	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
19	PDB:7rroH7	0.227	0.393	4.530E-7	580	0.069	0.138	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:2z6gA	0.198	0.347	1.138E-6	550	0.075	0.156	2z6gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AM24	0.0	2016	1180	0.888	0.868	A0A8I6AM24_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
2	O14617	0.0	2378	1153	1.000	1.000	AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1
3	P54362	0.0	994	1034	0.452	0.504	AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster OX=7227 GN=g PE=1 SV=4
4	Q54WN0	0.0	749	1143	0.408	0.412	AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum OX=44689 GN=ap3d1 PE=3 SV=1
5	Q6PK82	0.0	1759	865	0.742	0.988	Q6PK82_HUMAN AP3D1 protein (Fragment) OS=Homo sapiens OX=9606 GN=AP3D1 PE=2 SV=1
6	Q9UTL8	1.87e-160	499	825	0.238	0.332	AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl5 PE=3 SV=2
7	Q5RK16	2.16e-146	442	266	0.184	0.797	Q5RK16_RAT Ap3d1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=2 SV=1
8	B5DFK6	2.18e-135	443	1204	0.184	0.176	B5DFK6_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
9	A0A8I6GAS3	3.31e-135	443	1193	0.184	0.178	A0A8I6GAS3_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
10	O54774	8.12e-135	442	1199	0.185	0.178	AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus OX=10090 GN=Ap3d1 PE=1 SV=1
11	Q9C744	5.44e-134	431	869	0.206	0.273	AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana OX=3702 GN=DELTA-ADR PE=1 SV=1
12	Q4FZT4	1.59e-94	300	152	0.121	0.921	Q4FZT4_RAT Ap3d1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=2 SV=1
13	Q8WQB3	8.39e-46	180	829	0.107	0.148	Q8WQB3_CAEEL AP-1 complex subunit gamma OS=Caenorhabditis elegans OX=6239 GN=apg-1 PE=1 SV=1
14	Q8I8U2	5.16e-44	175	895	0.109	0.141	AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum OX=44689 GN=ap1g1 PE=1 SV=1
15	B0R024	1.87e-39	160	794	0.100	0.145	B0R024_DANRE AP-1 complex subunit gamma OS=Danio rerio OX=7955 GN=fc07e03 PE=1 SV=1
16	B2RYN6	2.43e-39	160	822	0.125	0.175	B2RYN6_RAT AP-1 complex subunit gamma OS=Rattus norvegicus OX=10116 GN=Ap1g1 PE=1 SV=1
17	P22892	2.65e-39	160	822	0.125	0.175	AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus OX=10090 GN=Ap1g1 PE=1 SV=3
18	A0A8I6AE72	3.08e-39	159	789	0.104	0.152	A0A8I6AE72_RAT AP-1 complex subunit gamma OS=Rattus norvegicus OX=10116 GN=Ap1g1 PE=1 SV=1
19	O43747	3.51e-39	159	822	0.125	0.175	AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5
20	B3KXW5	4.11e-39	159	845	0.125	0.170	B3KXW5_HUMAN AP-1 complex subunit gamma OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	6e-150	511.9	Adaptin N terminal region
2	PF06375 AP3D1	2.6e-45	165.8	AP-3 complex subunit delta-1
3	PF12717 Cnd1	4.7e-14	64.2	non-SMC mitotic condensation complex subunit 1
4	PF02985 HEAT	0.0008	30.5	HEAT repeat
5	PF13646 HEAT_2	0.002	29.8	HEAT repeats
6	PF20168 PDS5	0.011	25.2	Sister chromatid cohesion protein PDS5 protein
7	PF14663 RasGEF_N_2	1.8	20.4	Rapamycin-insensitive companion of mTOR RasGEF_N domain
8	PF10363 RTP1_C1	0.053	25.0	Required for nuclear transport of RNA pol II C-terminus 1
9	PF12755 Vac14_Fab1_bd	49	16.0	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000255194	0.999	AP-3 complex subunit beta-1
2	9606.ENSP00000325369	0.999	AP-3 complex subunit sigma-1
3	9606.ENSP00000347408	0.999	AP-3 complex subunit mu-1
4	9606.ENSP00000338777	0.997	AP-3 complex subunit sigma-2
5	9606.ENSP00000428787	0.991	AP-3 complex subunit mu-2
6	9606.ENSP00000440984	0.975	AP-3 complex subunit beta-2
7	9606.ENSP00000309457	0.928	Vacuolar protein sorting-associated protein 41 homolog
8	9606.ENSP00000358582	0.880	AP-4 complex subunit beta-1
9	9606.ENSP00000262640	0.874	Vesicle-associated membrane protein 7
10	9606.ENSP00000263270	0.865	AP-2 complex subunit sigma
11	9606.ENSP00000216366	0.857	AP-4 complex subunit sigma-1
12	9606.ENSP00000352603	0.849	AP-4 complex subunit mu-1
13	9606.ENSP00000381377	0.823	C15orf38-AP3S2 readthrough
14	9606.ENSP00000292807	0.811	AP-2 complex subunit mu
15	9606.ENSP00000335193	0.811	Vam6/Vps39-like protein
16	9606.ENSP00000233535	0.801	Zinc transporter 3
17	9606.ENSP00000261558	0.766	AP-5 complex subunit mu-1
18	9606.ENSP00000377148	0.765	AP-1 complex subunit gamma-1
19	9606.ENSP00000336666	0.760	AP-1 complex subunit sigma-1A
20	9606.ENSP00000388996	0.743	AP-1 complex subunit mu-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016050	0.989	vesicle organization
GO:0051649	0.988	establishment of localization in cell
GO:0006810	0.975	transport
GO:0016192	0.964	vesicle-mediated transport
GO:0046907	0.955	intracellular transport
GO:0016197	0.879	endosomal transport
GO:0036465	0.836	synaptic vesicle recycling
GO:0006900	0.739	vesicle budding from membrane
GO:0048489	0.730	synaptic vesicle transport
GO:0065007	0.451	biological regulation
GO:0050789	0.428	regulation of biological process
GO:0050794	0.337	regulation of cellular process
GO:0008104	0.337	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0098588	0.998	bounding membrane of organelle
GO:0031982	0.996	vesicle
GO:0097708	0.992	intracellular vesicle
GO:0005773	0.986	vacuole
GO:0031410	0.984	cytoplasmic vesicle
GO:0005764	0.978	lysosome
GO:0005765	0.970	lysosomal membrane
GO:0005794	0.903	Golgi apparatus
GO:0005829	0.883	cytosol
GO:0030659	0.856	cytoplasmic vesicle membrane
GO:0005768	0.847	endosome
GO:0010008	0.630	endosome membrane
GO:0031984	0.545	organelle subcompartment
GO:0032991	0.393	protein-containing complex
GO:0098791	0.314	Golgi apparatus subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]