StarFunc result for job id O14628

User Input

>input (629 residues)
MTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRK
EPWNVKRQEAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSV
DKFTALCSPGVLQTVKWFLEFRCIFSLAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGL
DNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNFSNLHRRNISNTG
EKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEPENIDTGEKPY
KCQECNNVIKTCSVLTKNRIYAGGEHYRCEEFGKVFNQCSHLTEHEHGTEEKPCKYEECS
SVFISCSSLSNQQMILAGEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCEECDSIFK
WFSDLTKHKRIHTGEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSS
LSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVH
KRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIH
TGEKPYKCEKCGKAFTQFSHLTVHESIHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05481	0.272	0.159	2.244E-48	1191	0.502	0.265	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	AFDB:P17038	0.285	0.232	3.023E-48	809	0.517	0.402	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
3	AFDB:O75437	0.313	0.300	1.915E-47	659	0.493	0.470	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
4	AFDB:Q9H8G1	0.321	0.352	7.999E-47	570	0.458	0.505	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
5	AFDB:Q03936	0.277	0.295	1.540E-46	586	0.507	0.544	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
6	AFDB:Q8IW36	0.315	0.377	6.184E-45	515	0.477	0.583	Q8IW36.pdb.gz	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
7	AFDB:Q8NDQ6	0.344	0.331	2.292E-44	660	0.380	0.362	Q8NDQ6.pdb.gz	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1
8	AFDB:Q15928	0.317	0.414	1.016E-43	474	0.442	0.586	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
9	AFDB:Q8IYB9	0.316	0.308	1.453E-43	648	0.466	0.452	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
10	AFDB:Q6ECI4	0.353	0.311	2.077E-43	717	0.386	0.339	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	PDB:3w5kB	0.080	0.271	7.140E-5	110	0.062	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7oqyY	0.036	0.180	7.293E-1	92	0.030	0.207	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
13	PDB:4zynB	0.033	0.047	8.215E-1	385	0.033	0.055	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
14	PDB:7uhyD	0.038	0.074	8.719E-1	288	0.038	0.083	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:4kblA	0.046	0.062	9.254E-1	395	0.056	0.089	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
16	PDB:5tteB	0.059	0.072	9.822E-1	442	0.068	0.097	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
17	PDB:7td5A	0.058	0.068	9.822E-1	497	0.076	0.097	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:5n5yI	0.026	0.112	1.404	99	0.032	0.202	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
19	PDB:7d58L	0.048	0.521	1.679	47	0.016	0.213	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
20	PDB:7uhyC	0.046	0.049	2.007	578	0.029	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TD23	3.10e-179	521	568	0.490	0.542	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
2	O75437	7.64e-176	516	659	0.509	0.486	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P35789	5.59e-174	510	620	0.434	0.440	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
4	Q49A12	1.53e-173	506	536	0.447	0.524	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
5	Q03923	8.66e-173	506	595	0.445	0.471	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	A6NNF4	1.89e-171	503	616	0.434	0.443	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
7	P17038	1.72e-168	503	809	0.499	0.388	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
8	Q03936	3.00e-168	494	586	0.434	0.466	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
9	Q9UII5	1.53e-165	494	783	0.426	0.342	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
10	Q8IYB9	5.22e-165	488	648	0.472	0.458	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
11	Q05481	2.31e-163	500	1191	0.488	0.258	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
12	Q15928	1.79e-153	452	474	0.440	0.584	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
13	Q9H8G1	7.83e-151	449	570	0.388	0.428	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
14	Q2NKJ9	8.18e-151	449	569	0.388	0.429	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
15	Q14593	4.14e-149	444	569	0.388	0.429	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
16	Q96JC4	8.65e-149	442	524	0.386	0.464	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
17	Q6ZR52	3.13e-148	445	646	0.396	0.385	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
18	Q9P2J8	6.17e-148	451	865	0.428	0.311	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
19	Q76KX8	1.38e-147	444	674	0.431	0.402	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
20	Q8NDQ6	4.61e-144	435	660	0.423	0.403	ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens OX=9606 GN=ZNF540 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	1.5e+02	14.0	TFIIH C1-like domain
2	PF09237 GAGA	3.6e+02	12.6	GAGA factor
3	PF01352 KRAB	6e-20	81.9	KRAB box
4	PF10484 MRP-S23	1.3e+02	14.2	Mitochondrial ribosomal protein S23
5	PF01286 XPA_N	0.0048	28.2	XPA protein N-terminal
6	PF00096 zf-C2H2	3.8e-41	148.4	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	3.8	18.7	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	3.1e-16	69.7	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	1.6e-12	58.4	C2H2-type zinc finger
10	PF13465 zf-H2C2_2	5.2e-70	240.2	Zinc-finger double domain
11	PF13909 zf-H2C2_5	24	16.1	C2H2-type zinc-finger domain
12	PF02591 zf-RING_7	7.1	18.2	C4-type zinc ribbon domain
13	PF18439 zf_UBZ	1.2	20.2	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	3.5e+02	13.4	zinc-ribbon family
15	PF09723 Zn-ribbon_8	5.1e-05	34.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354958	0.518	Protein FAM189B
2	9606.ENSP00000445418	0.504	Protein FAM90A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.996	regulation of metabolic process
GO:0080090	0.994	regulation of primary metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0031324	0.923	negative regulation of cellular metabolic process
GO:0051172	0.922	negative regulation of nitrogen compound metabolic process
GO:0010605	0.910	negative regulation of macromolecule metabolic process
GO:0045934	0.881	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.878	negative regulation of cellular biosynthetic process
GO:0010558	0.876	negative regulation of macromolecule biosynthetic process
GO:1903507	0.827	negative regulation of nucleic acid-templated transcription
GO:0045892	0.810	negative regulation of DNA-templated transcription
GO:0009987	0.460	cellular process
GO:0050896	0.351	response to stimulus
GO:0048522	0.316	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0016020	0.820	membrane
GO:0005737	0.738	cytoplasm
GO:0005829	0.474	cytosol
GO:0005730	0.341	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]