StarFunc result for job id O14640

User Input

>input (695 residues)
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGS
GSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14640	0.999	0.999	0.000	695	1.000	1.000	O14640.pdb.gz	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
2	AFDB:P54792	0.236	0.243	1.234E-102	670	0.928	0.963	P54792.pdb.gz	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
3	AFDB:D4ADV8	0.464	0.454	5.546E-80	716	0.678	0.658	D4ADV8.pdb.gz	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
4	AFDB:Q6DKE2	0.274	0.268	2.206E-78	717	0.671	0.650	Q6DKE2.pdb.gz	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
5	AFDB:D3ZB71	0.423	0.407	4.112E-76	736	0.645	0.609	D3ZB71.pdb.gz	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
6	AFDB:F1QM97	0.241	0.227	1.432E-75	747	0.636	0.592	F1QM97.pdb.gz
7	AFDB:B8JMI2	0.413	0.422	3.337E-74	676	0.619	0.636	B8JMI2.pdb.gz	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
8	AFDB:P51142	0.358	0.343	4.904E-72	736	0.616	0.582	P51142.pdb.gz	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
9	AFDB:Q86TH3	0.134	0.207	9.618E-54	444	0.632	0.989	Q86TH3.pdb.gz	Q86TH3_HUMAN Dishevelled, dsh homolog 1 (Drosophila) OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=1
10	AFDB:H2KZ17	0.165	0.164	5.692E-45	702	0.347	0.343	H2KZ17.pdb.gz	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
11	PDB:7p73A	0.117	0.190	1.045E-5	420	0.046	0.076	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
12	PDB:7pc3A	0.116	0.197	1.045E-5	405	0.046	0.079	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:5n7dA	0.120	0.193	3.046E-5	423	0.032	0.052	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
14	PDB:2xkxA	0.117	0.113	4.350E-5	721	0.046	0.044	2xkxA.pdb.gz
15	PDB:7pc5A	0.118	0.200	6.593E-5	405	0.039	0.067	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7qqmA	0.121	0.199	6.997E-5	413	0.035	0.058	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7p70A	0.115	0.190	1.515E-4	407	0.037	0.064	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:6t36A	0.116	0.728	8.482E-4	93	0.016	0.118	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
19	PDB:6pcvA	0.108	0.099	1.142E-3	754	0.032	0.029	6pcvA.pdb.gz
20	PDB:7qqnC	0.107	0.175	1.364E-3	414	0.030	0.051	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GKX7	0.0	633	727	0.599	0.572	A0A8I6GKX7_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=1
2	B8JMI2	0.0	688	676	0.610	0.627	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
3	D3ZB71	0.0	682	736	0.635	0.599	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
4	D4ADV8	0.0	723	718	0.643	0.623	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
5	I3L2N2	0.0	654	730	0.612	0.582	I3L2N2_HUMAN Dishevelled segment polarity protein 2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
6	O14640	0.0	1424	695	1.000	1.000	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
7	O14641	0.0	670	736	0.623	0.588	DVL2_HUMAN Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
8	P51141	0.0	1167	695	0.950	0.950	DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 OS=Mus musculus OX=10090 GN=Dvl1 PE=1 SV=2
9	P51142	0.0	665	736	0.606	0.572	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
10	P54792	0.0	1125	670	0.928	0.963	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
11	Q60838	0.0	683	736	0.622	0.587	DVL2_MOUSE Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus OX=10090 GN=Dvl2 PE=1 SV=2
12	Q61062	0.0	739	716	0.652	0.633	DVL3_MOUSE Segment polarity protein dishevelled homolog DVL-3 OS=Mus musculus OX=10090 GN=Dvl3 PE=1 SV=2
13	Q6DKE2	0.0	809	717	0.665	0.644	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
14	Q803Q5	0.0	710	747	0.620	0.577	Q803Q5_DANRE Dishevelled, dsh homolog 2 (Drosophila) OS=Danio rerio OX=7955 GN=wu:fo71e09 PE=1 SV=1
15	Q92997	0.0	741	716	0.653	0.634	DVL3_HUMAN Segment polarity protein dishevelled homolog DVL-3 OS=Homo sapiens OX=9606 GN=DVL3 PE=1 SV=2
16	Q9WVB9	0.0	1170	695	0.951	0.951	DVL1_RAT Segment polarity protein dishevelled homolog DVL-1 OS=Rattus norvegicus OX=10116 GN=Dvl1 PE=1 SV=3
17	P51140	2.02e-142	432	623	0.355	0.396	DSH_DROME Segment polarity protein dishevelled OS=Drosophila melanogaster OX=7227 GN=dsh PE=1 SV=2
18	Q86TH3	7.05e-124	377	444	0.325	0.509	Q86TH3_HUMAN Dishevelled, dsh homolog 1 (Drosophila) OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=1
19	B7WN58	3.62e-103	330	636	0.334	0.365	B7WN58_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
20	H2KZ17	1.03e-102	331	702	0.327	0.323	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	1.7e-12	58.5	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF02377 Dishevelled	9.1e-59	209.8	Dishevelled specific domain
3	PF00778 DIX	5e-26	101.7	DIX domain
4	PF12316 Dsh_C	3.1e-53	192.8	Segment polarity protein dishevelled (Dsh) C terminal
5	PF00595 PDZ	4.2e-17	73.6	PDZ domain
6	PF13180 PDZ_2	44	15.9	PDZ domain
7	PF17820 PDZ_6	0.54	21.5	PDZ domain
8	PF04917 Shufflon_N	1.3e+02	13.5	Bacterial shufflon protein, N-terminal constant region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000005721

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000008683	0.988	VANGL planar cell polarity protein 1
2	9555.ENSPANP00000013446	0.986	Uncharacterized protein
3	9555.ENSPANP00000016496	0.985	Axin 2
4	9555.ENSPANP00000009188	0.976	Frizzled class receptor 5
5	9555.ENSPANP00000008458	0.975	Frizzled class receptor 7
6	9555.ENSPANP00000012679	0.975	Naked cuticle homolog 1 (Drosophila)
7	9555.ENSPANP00000004139	0.974	Naked cuticle homolog 2 (Drosophila)
8	9555.ENSPANP00000018341	0.972	Prickle planar cell polarity protein 1
9	9555.ENSPANP00000005934	0.971	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
10	9555.ENSPANP00000019605	0.971	Dishevelled segment polarity protein 2
11	9555.ENSPANP00000010830	0.970	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
12	9555.ENSPANP00000003979	0.969	Frizzled class receptor 4
13	9555.ENSPANP00000020754	0.969	FRAT1, WNT signaling pathway regulator
14	9555.ENSPANP00000019013	0.966	Frizzled class receptor 6
15	9555.ENSPANP00000017020	0.965	Dishevelled associated activator of morphogenesis 1
16	9555.ENSPANP00000009337	0.964	Papio anubis frizzled family receptor 1 (FZD1), mRNA
17	9555.ENSPANP00000006569	0.962	Frizzled class receptor 3
18	9555.ENSPANP00000013318	0.962	Casein kinase 1, epsilon
19	9555.ENSPANP00000005232	0.961	Glycogen synthase kinase 3 beta
20	9555.ENSPANP00000019037	0.961	Inversin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0019900	0.995	kinase binding
GO:0042802	0.991	identical protein binding
GO:0005109	0.987	frizzled binding
GO:0019901	0.973	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0007165	0.987	signal transduction
GO:0048856	0.985	anatomical structure development
GO:0007166	0.983	cell surface receptor signaling pathway
GO:0007267	0.978	cell-cell signaling
GO:0019222	0.960	regulation of metabolic process
GO:0048518	0.936	positive regulation of biological process
GO:0032501	0.934	multicellular organismal process
GO:0048522	0.928	positive regulation of cellular process
GO:0035567	0.927	non-canonical Wnt signaling pathway
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0007275	0.911	multicellular organism development
GO:0031323	0.902	regulation of cellular metabolic process
GO:0080090	0.895	regulation of primary metabolic process
GO:0060070	0.895	canonical Wnt signaling pathway
GO:0051171	0.893	regulation of nitrogen compound metabolic process
GO:0022603	0.877	regulation of anatomical structure morphogenesis
GO:0009653	0.859	anatomical structure morphogenesis
GO:0051174	0.828	regulation of phosphorus metabolic process
GO:0071840	0.821	cellular component organization or biogenesis
GO:0009893	0.817	positive regulation of metabolic process
GO:0016043	0.809	cellular component organization
GO:0042325	0.809	regulation of phosphorylation
GO:0010646	0.807	regulation of cell communication
GO:0023051	0.805	regulation of signaling
GO:0048583	0.799	regulation of response to stimulus
GO:0048731	0.784	system development
GO:0031399	0.784	regulation of protein modification process
GO:0009888	0.750	tissue development
GO:0051128	0.727	regulation of cellular component organization
GO:0009966	0.716	regulation of signal transduction
GO:0048519	0.697	negative regulation of biological process
GO:0051173	0.661	positive regulation of nitrogen compound metabolic process
GO:0065009	0.647	regulation of molecular function
GO:0010604	0.636	positive regulation of macromolecule metabolic process
GO:2000027	0.632	regulation of animal organ morphogenesis
GO:0001932	0.628	regulation of protein phosphorylation
GO:0065008	0.623	regulation of biological quality
GO:0051247	0.623	positive regulation of protein metabolic process
GO:0090175	0.616	regulation of establishment of planar polarity
GO:0031325	0.611	positive regulation of cellular metabolic process
GO:0048523	0.601	negative regulation of cellular process
GO:0022604	0.596	regulation of cell morphogenesis
GO:0031344	0.521	regulation of cell projection organization
GO:0010468	0.468	regulation of gene expression
GO:0048729	0.467	tissue morphogenesis
GO:0060429	0.464	epithelium development
GO:0031326	0.456	regulation of cellular biosynthetic process
GO:0010556	0.453	regulation of macromolecule biosynthetic process
GO:0019219	0.451	regulation of nucleobase-containing compound metabolic process
GO:0002009	0.439	morphogenesis of an epithelium
GO:0050790	0.438	regulation of catalytic activity
GO:0042221	0.423	response to chemical
GO:0051252	0.410	regulation of RNA metabolic process
GO:0051130	0.388	positive regulation of cellular component organization
GO:0007399	0.379	nervous system development
GO:0048584	0.366	positive regulation of response to stimulus
GO:0006355	0.363	regulation of DNA-templated transcription
GO:0010557	0.342	positive regulation of macromolecule biosynthetic process
GO:0051172	0.332	negative regulation of nitrogen compound metabolic process
GO:0031324	0.332	negative regulation of cellular metabolic process
GO:0045935	0.322	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.319	positive regulation of cellular biosynthetic process
GO:0051338	0.309	regulation of transferase activity
GO:0010605	0.307	negative regulation of macromolecule metabolic process
GO:0023056	0.305	positive regulation of signaling
GO:0010647	0.305	positive regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0005829	0.992	cytosol
GO:0016020	0.990	membrane
GO:0071944	0.986	cell periphery
GO:0005886	0.980	plasma membrane
GO:0031982	0.975	vesicle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0042995	0.936	cell projection
GO:0005634	0.928	nucleus
GO:0043232	0.899	intracellular non-membrane-bounded organelle
GO:0120025	0.890	plasma membrane bounded cell projection
GO:0043005	0.791	neuron projection
GO:0012505	0.776	endomembrane system
GO:0031410	0.756	cytoplasmic vesicle
GO:0032991	0.744	protein-containing complex
GO:0070013	0.702	intracellular organelle lumen
GO:0031981	0.677	nuclear lumen
GO:0005654	0.668	nucleoplasm
GO:0015630	0.604	microtubule cytoskeleton
GO:0030424	0.358	axon
GO:0030054	0.304	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]