StarFunc result for job id O14641

User Input

>input (736 residues)
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZB71	0.396	0.396	0.000	736	0.961	0.961	D3ZB71.pdb.gz	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
2	AFDB:F1QM97	0.193	0.190	1.756E-84	747	0.736	0.726	F1QM97.pdb.gz
3	AFDB:D4ADV8	0.456	0.467	2.317E-81	716	0.697	0.716	D4ADV8.pdb.gz	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
4	AFDB:Q6DKE2	0.217	0.222	4.366E-78	717	0.673	0.690	Q6DKE2.pdb.gz	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
5	AFDB:O14640	0.310	0.324	3.466E-73	695	0.592	0.627	O14640.pdb.gz	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
6	AFDB:B8JMI2	0.347	0.370	8.787E-70	676	0.587	0.639	B8JMI2.pdb.gz	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
7	AFDB:P54792	0.264	0.284	1.114E-69	670	0.573	0.630	P54792.pdb.gz	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
8	AFDB:H2KZ17	0.169	0.176	7.703E-44	702	0.326	0.342	H2KZ17.pdb.gz	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
9	AFDB:Q18239	0.188	0.184	2.826E-39	759	0.264	0.256	Q18239.pdb.gz	Q18239_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-2 PE=1 SV=5
10	AFDB:Q22227	0.193	0.205	7.165E-36	672	0.254	0.278	Q22227.pdb.gz	MIG5_CAEEL Segment polarity protein dishevelled homolog mig-5 OS=Caenorhabditis elegans OX=6239 GN=mig-5 PE=1 SV=1
11	PDB:7pc3A	0.113	0.201	3.214E-6	405	0.043	0.079	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:5n7dA	0.113	0.192	1.597E-5	423	0.030	0.052	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
13	PDB:7p73A	0.108	0.186	2.568E-5	420	0.041	0.071	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7pc5A	0.111	0.198	4.382E-5	405	0.037	0.067	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7qqmA	0.112	0.194	8.421E-5	413	0.033	0.058	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7p70A	0.115	0.202	1.276E-4	407	0.034	0.061	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:2xkxA	0.106	0.109	2.311E-4	721	0.041	0.042	2xkxA.pdb.gz
18	PDB:7qqnC	0.104	0.180	8.533E-4	414	0.031	0.056	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:6pcvA	0.100	0.098	1.545E-3	754	0.031	0.031	6pcvA.pdb.gz
20	PDB:7rx9A	0.102	0.170	2.485E-3	432	0.031	0.053	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GKX7	0.0	661	727	0.620	0.627	A0A8I6GKX7_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=1
2	B8JMI2	0.0	676	676	0.572	0.623	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
3	D3ZB71	0.0	1169	736	0.947	0.947	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
4	D4ADV8	0.0	753	718	0.655	0.671	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
5	I3L2N2	0.0	1470	730	0.992	1.000	I3L2N2_HUMAN Dishevelled segment polarity protein 2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
6	O14640	0.0	649	695	0.576	0.610	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
7	O14641	0.0	1487	736	1.000	1.000	DVL2_HUMAN Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
8	P51141	0.0	679	695	0.590	0.624	DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 OS=Mus musculus OX=10090 GN=Dvl1 PE=1 SV=2
9	P51142	0.0	887	736	0.765	0.765	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
10	P54792	0.0	642	670	0.571	0.627	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
11	Q60838	0.0	1432	736	0.966	0.966	DVL2_MOUSE Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus OX=10090 GN=Dvl2 PE=1 SV=2
12	Q61062	0.0	768	716	0.666	0.684	DVL3_MOUSE Segment polarity protein dishevelled homolog DVL-3 OS=Mus musculus OX=10090 GN=Dvl3 PE=1 SV=2
13	Q6DKE2	0.0	848	717	0.671	0.689	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
14	Q803Q5	0.0	877	747	0.715	0.704	Q803Q5_DANRE Dishevelled, dsh homolog 2 (Drosophila) OS=Danio rerio OX=7955 GN=wu:fo71e09 PE=1 SV=1
15	Q92997	0.0	766	716	0.666	0.684	DVL3_HUMAN Segment polarity protein dishevelled homolog DVL-3 OS=Homo sapiens OX=9606 GN=DVL3 PE=1 SV=2
16	Q9WVB9	0.0	682	695	0.599	0.635	DVL1_RAT Segment polarity protein dishevelled homolog DVL-1 OS=Rattus norvegicus OX=10116 GN=Dvl1 PE=1 SV=3
17	P51140	5.33e-111	352	623	0.251	0.297	DSH_DROME Segment polarity protein dishevelled OS=Drosophila melanogaster OX=7227 GN=dsh PE=1 SV=2
18	B7WN58	3.38e-98	318	636	0.299	0.346	B7WN58_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
19	H2KZ17	7.79e-98	319	702	0.299	0.313	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
20	B1Q240	5.23e-81	279	915	0.261	0.210	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	3.2e-13	60.8	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF02377 Dishevelled	8.6e-56	200.2	Dishevelled specific domain
3	PF00778 DIX	3.8e-27	105.3	DIX domain
4	PF12316 Dsh_C	5.1e-70	247.6	Segment polarity protein dishevelled (Dsh) C terminal
5	PF00595 PDZ	1.5e-14	65.4	PDZ domain
6	PF13180 PDZ_2	44	15.9	PDZ domain
7	PF17820 PDZ_6	1.3	20.3	PDZ domain
8	PF04917 Shufflon_N	1.3e+02	13.4	Bacterial shufflon protein, N-terminal constant region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000005340

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.999	Axin-1
2	9606.ENSP00000378557	0.997	Disheveled-associated activator of morphogenesis 1
3	9606.ENSP00000357040	0.994	Vang-like protein 2
4	9606.ENSP00000344456	0.993	Catenin beta-1
5	9606.ENSP00000261349	0.992	Low-density lipoprotein receptor-related protein 6
6	9606.ENSP00000300093	0.992	Serine/threonine-protein kinase PLK1
7	9606.ENSP00000347672	0.992	VANGL planar cell polarity protein 1
8	9606.ENSP00000337439	0.991	Dapper homolog 1
9	9606.ENSP00000345064	0.990	Prickle-like protein 1
10	9606.ENSP00000380044	0.990	Casein kinase I isoform epsilon
11	9606.ENSP00000264634	0.987	Protein Wnt-5a
12	9606.ENSP00000403701	0.987	Beta-arrestin-2
13	9606.ENSP00000284523	0.984	Protein Wnt-3a
14	9606.ENSP00000324806	0.984	Glycogen synthase kinase-3 beta
15	9606.ENSP00000354607	0.984	Frizzled-5
16	9606.ENSP00000268459	0.983	Protein naked cuticle homolog 1
17	9606.ENSP00000368169	0.982	Segment polarity protein dishevelled homolog DVL-1
18	9606.ENSP00000351605	0.981	Frizzled-6
19	9606.ENSP00000286201	0.980	Frizzled-7
20	9606.ENSP00000400175	0.976	Transforming protein RhoA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0042802	0.996	identical protein binding
GO:0005109	0.993	frizzled binding
GO:0019899	0.889	enzyme binding
GO:0019901	0.627	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0198738	0.980	cell-cell signaling by wnt
GO:1905114	0.979	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0048518	0.974	positive regulation of biological process
GO:0048856	0.959	anatomical structure development
GO:0019222	0.954	regulation of metabolic process
GO:0060070	0.946	canonical Wnt signaling pathway
GO:0023051	0.912	regulation of signaling
GO:0048522	0.909	positive regulation of cellular process
GO:0032501	0.892	multicellular organismal process
GO:0035567	0.875	non-canonical Wnt signaling pathway
GO:0051338	0.874	regulation of transferase activity
GO:0045859	0.847	regulation of protein kinase activity
GO:0001934	0.845	positive regulation of protein phosphorylation
GO:0010646	0.840	regulation of cell communication
GO:0051347	0.835	positive regulation of transferase activity
GO:0090175	0.831	regulation of establishment of planar polarity
GO:0071900	0.825	regulation of protein serine/threonine kinase activity
GO:0043410	0.815	positive regulation of MAPK cascade
GO:0071902	0.815	positive regulation of protein serine/threonine kinase activity
GO:0043406	0.771	positive regulation of MAP kinase activity
GO:0007275	0.768	multicellular organism development
GO:0043507	0.747	positive regulation of JUN kinase activity
GO:0048731	0.662	system development
GO:0009888	0.654	tissue development
GO:0009653	0.582	anatomical structure morphogenesis
GO:0060429	0.579	epithelium development
GO:0051128	0.530	regulation of cellular component organization
GO:0010468	0.525	regulation of gene expression
GO:0002009	0.477	morphogenesis of an epithelium
GO:0007399	0.469	nervous system development
GO:0048519	0.467	negative regulation of biological process
GO:0048523	0.462	negative regulation of cellular process
GO:0031326	0.438	regulation of cellular biosynthetic process
GO:0010556	0.437	regulation of macromolecule biosynthetic process
GO:0019219	0.435	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.423	regulation of RNA metabolic process
GO:0071840	0.413	cellular component organization or biogenesis
GO:0016043	0.381	cellular component organization
GO:0006355	0.381	regulation of DNA-templated transcription
GO:0021915	0.368	neural tube development
GO:0060026	0.317	convergent extension
GO:0048513	0.304	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005654	0.990	nucleoplasm
GO:0071944	0.975	cell periphery
GO:0016020	0.962	membrane
GO:0005886	0.932	plasma membrane
GO:0031982	0.879	vesicle
GO:0031410	0.784	cytoplasmic vesicle
GO:0043232	0.491	intracellular non-membrane-bounded organelle
GO:0012505	0.445	endomembrane system
GO:0030135	0.320	coated vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]