StarFunc result for job id O14645

User Input

>input (258 residues)
MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPD
PTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGI
CPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKAL
QAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLK
RTNQQLKAQLEGIIAPKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14645	1.000	1.000	6.238E-41	258	1.000	1.000	O14645.pdb.gz	IDLC_HUMAN Axonemal dynein light intermediate polypeptide 1 OS=Homo sapiens OX=9606 GN=DNALI1 PE=1 SV=2
2	AFDB:Q6GN86	0.802	0.814	3.834E-33	254	0.829	0.843	Q6GN86.pdb.gz	IDLC_XENLA Axonemal dynein light intermediate polypeptide 1 OS=Xenopus laevis OX=8355 GN=dnali1 PE=2 SV=1
3	AFDB:Q39604	0.795	0.811	9.517E-27	253	0.628	0.640	Q39604.pdb.gz	IDLC_CHLRE 28 kDa inner dynein arm light chain, axonemal OS=Chlamydomonas reinhardtii OX=3055 GN=IDA4 PE=1 SV=1
4	AFDB:Q385L7	0.698	0.760	4.433E-20	235	0.496	0.545	Q385L7.pdb.gz	Q385L7_TRYB2 Dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3200 PE=4 SV=1
5	AFDB:Q389G1	0.491	0.346	2.588E-14	373	0.271	0.188	Q389G1.pdb.gz	Q389G1_TRYB2 33 kDa inner dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0070 PE=4 SV=1
6	PDB:7ju4v	0.346	0.568	4.000E-13	152	0.426	0.724	7ju4v.pdb.gz	Structures of radial spokes and associated complexes important for ciliary motility.
7	AFDB:Q57VS8	0.533	0.459	4.125E-13	306	0.287	0.242	Q57VS8.pdb.gz	Q57VS8_TRYB2 Dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.440 PE=4 SV=1
8	AFDB:O76064	0.164	0.089	5.138E-2	485	0.140	0.074	O76064.pdb.gz	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
9	AFDB:Q0WNB1	0.259	0.270	1.406E-1	243	0.163	0.173	Q0WNB1.pdb.gz	DUF5_ARATH DUF724 domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=DUF5 PE=1 SV=1
10	AFDB:Q3UZZ4	0.149	0.083	1.809E-1	505	0.120	0.061	Q3UZZ4.pdb.gz	OLFM4_MOUSE Olfactomedin-4 OS=Mus musculus OX=10090 GN=Olfm4 PE=2 SV=1
11	AFDB:Q7TNJ2	0.101	0.025	2.051E-1	2170	0.078	0.009	Q7TNJ2.pdb.gz	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
12	PDB:4bvuA	0.099	0.129	4.507E-1	171	0.066	0.099	4bvuA.pdb.gz
13	PDB:1ek8A	0.144	0.193	7.941E-1	185	0.050	0.070	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
14	PDB:6fyxl	0.078	0.131	8.457E-1	128	0.031	0.062	6fyxl.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
15	PDB:6hixBN	0.105	0.121	1.158	214	0.066	0.079	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:5nzuD	0.107	0.069	1.314	427	0.066	0.040	5nzuD.pdb.gz
17	PDB:7nshBG	0.087	0.107	1.314	196	0.039	0.051	7nshBG.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
18	PDB:2xmaE	0.077	0.126	1.690	141	0.043	0.078	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
19	PDB:7mqaSW	0.082	0.104	1.690	195	0.039	0.051	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5lsbA	0.093	0.125	1.799	176	0.039	0.057	5lsbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14645	0.0	522	258	1.000	1.000	IDLC_HUMAN Axonemal dynein light intermediate polypeptide 1 OS=Homo sapiens OX=9606 GN=DNALI1 PE=1 SV=2
2	Q8BVN8	0.0	499	258	0.957	0.957	IDLC_MOUSE Axonemal dynein light intermediate polypeptide 1 OS=Mus musculus OX=10090 GN=Dnali1 PE=1 SV=1
3	Q6GN86	1.73e-148	416	254	0.810	0.823	IDLC_XENLA Axonemal dynein light intermediate polypeptide 1 OS=Xenopus laevis OX=8355 GN=dnali1 PE=2 SV=1
4	Q39604	5.60e-108	314	253	0.620	0.632	IDLC_CHLRE 28 kDa inner dynein arm light chain, axonemal OS=Chlamydomonas reinhardtii OX=3055 GN=IDA4 PE=1 SV=1
5	Q385L7	1.10e-80	244	235	0.512	0.562	Q385L7_TRYB2 Dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3200 PE=4 SV=1
6	Q57VS8	4.34e-31	119	306	0.244	0.206	Q57VS8_TRYB2 Dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.29K4.440 PE=4 SV=1
7	Q389G1	5.40e-25	103	373	0.240	0.166	Q389G1_TRYB2 33 kDa inner dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0070 PE=4 SV=1
8	Q8IDX6	0.056	37.4	3130	0.081	0.007	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
9	Q05040	0.40	34.3	523	0.070	0.034	FAR8_YEAST Factor arrest protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAR8 PE=1 SV=1
10	Q9LI74	2.3	32.0	1004	0.178	0.046	CHUP1_ARATH Protein CHUP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHUP1 PE=1 SV=1
11	Q2M243	2.4	32.0	656	0.101	0.040	CCD27_HUMAN Coiled-coil domain-containing protein 27 OS=Homo sapiens OX=9606 GN=CCDC27 PE=1 SV=2
12	Q8II80	2.4	32.0	1570	0.070	0.011	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
13	J3QT39	2.7	32.0	905	0.178	0.051	J3QT39_HUMAN Coiled-coil domain containing 14 OS=Homo sapiens OX=9606 GN=CCDC14 PE=1 SV=2
14	Q49A88	2.8	32.0	953	0.178	0.048	CCD14_HUMAN Coiled-coil domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CCDC14 PE=1 SV=3
15	Q23664	3.4	31.2	253	0.054	0.055	Q23664_CAEEL C4H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-23 PE=1 SV=4
16	Q65ZB3	3.5	30.8	199	0.054	0.070	Q65ZB3_CAEEL C4H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-23 PE=1 SV=1
17	A0A0A0MR27	3.8	31.6	864	0.178	0.053	A0A0A0MR27_HUMAN Coiled-coil domain containing 14 OS=Homo sapiens OX=9606 GN=CCDC14 PE=1 SV=1
18	Q9ULD2	4.4	31.2	1270	0.171	0.035	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
19	Q4R918	9.1	30.0	586	0.093	0.041	KIF25_MACFA Kinesin-like protein KIF25 OS=Macaca fascicularis OX=9541 GN=KIF25 PE=1 SV=1
20	P38764	10.0	30.0	993	0.062	0.016	RPN1_YEAST 26S proteasome regulatory subunit RPN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10211 Ax_dynein_light	6e-87	301.9	Axonemal dynein light chain
2	PF05914 RIB43A	2.5	18.5	RIB43A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400252	0.914	Dynein intermediate chain 2, axonemal
2	9606.ENSP00000265104	0.911	Dynein heavy chain 5, axonemal
3	9606.ENSP00000367815	0.906	Dynein assembly factor 1, axonemal
4	9606.ENSP00000268699	0.849	Growth arrest-specific protein 8
5	9606.ENSP00000405708	0.839	Coiled-coil domain-containing protein 39
6	9606.ENSP00000298292	0.832	Protein kintoun
7	9606.ENSP00000484634	0.823	Protein tilB homolog
8	9606.ENSP00000254286	0.813	Actin related protein 10 homolog
9	9606.ENSP00000289228	0.813	Beta-centractin
10	9606.ENSP00000358921	0.813	Alpha-centractin
11	9606.ENSP00000480538	0.811	Dynein intermediate chain 1, axonemal
12	9606.ENSP00000334002	0.801	Huntingtin-associated protein 1
13	9606.ENSP00000221114	0.800	Dynactin subunit 6
14	9606.ENSP00000259632	0.800	Dynactin subunit 3
15	9606.ENSP00000300087	0.800	Dynactin subunit 5
16	9606.ENSP00000354791	0.800	Dynactin subunit 1
17	9606.ENSP00000408910	0.800	Dynactin subunit 2
18	9606.ENSP00000414906	0.800	Dynactin subunit 4
19	9606.ENSP00000262442	0.792	Dynein heavy chain 9, axonemal
20	9606.ENSP00000380679	0.748	Coiled-coil domain-containing protein 40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0003341	0.982	cilium movement
GO:0071840	0.700	cellular component organization or biogenesis
GO:0006996	0.691	organelle organization
GO:0044085	0.659	cellular component biogenesis
GO:0000226	0.650	microtubule cytoskeleton organization
GO:0044782	0.647	cilium organization
GO:0120031	0.647	plasma membrane bounded cell projection assembly
GO:0070925	0.644	organelle assembly
GO:0001578	0.621	microtubule bundle formation
GO:0060271	0.598	cilium assembly
GO:0035082	0.509	axoneme assembly
GO:0070286	0.310	axonemal dynein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.997	cytoskeleton
GO:0097014	0.995	ciliary plasm
GO:0005930	0.994	axoneme
GO:0031514	0.979	motile cilium
GO:0097729	0.951	9+2 motile cilium
GO:0036126	0.783	sperm flagellum
GO:0005875	0.502	microtubule associated complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]