StarFunc result for job id O14646

User Input

>input (1710 residues)
MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGS
QSESESDTSRENKVQAKPPKVDGAEFWKSSPSILAVQRSAILKKQQQQQQQQQHQASSNS
GSEEDSSSSEDSDDSSSEVKRKKHKDEDWQMSGSGSPSQSGSDSESEEEREKSSCDETES
DYEPKNKVKSRKPQNRSKSKNGKKILGQKKRQIDSSEEDDDEEDYDNDKRSSRRQATVNV
SYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDCRIGRKGATGATTTIYAVEAD
GDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETK
RWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSE
CSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEGLE
LRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLS
TLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLKDK
AFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFI
MPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSA
LQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQEAL
QHLIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKG
ELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHR
IGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSSTPF
NKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQFK
VANFSNMDEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAKQI
SFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKK
FGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVKGP
TFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSN
LLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKK
EALSGAGSSKRRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGRER
SKKSSVSDAPVHITASGEPVPISEESEELDQKTFSICKERMRPVKAALKQLDRPEKGLSE
REQLEHTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTEFDARKLHKLYKHA
IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDR
HQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLE
GSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLD
QRSPYGSRSPFEHSVEHKSTPEHTWSSRKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IR86	0.604	0.575	0.000	1799	0.587	0.558	A0A0R4IR86.pdb.gz	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
2	AFDB:P40201	0.729	0.729	0.000	1711	0.958	0.958	P40201.pdb.gz	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
3	AFDB:E9PU01	0.358	0.321	2.861E-67	1921	0.266	0.237	E9PU01.pdb.gz	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4
4	AFDB:O97159	0.360	0.313	6.668E-64	1982	0.253	0.218	O97159.pdb.gz	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2
5	PDB:6g0lM	0.384	0.736	4.002E-55	855	0.220	0.440	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
6	PDB:6g0lW	0.417	0.774	9.574E-55	878	0.221	0.431	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
7	PDB:6jylK	0.257	0.840	1.209E-40	504	0.139	0.472	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
8	AFDB:Q9VL72	0.251	0.494	5.269E-37	844	0.118	0.238	Q9VL72.pdb.gz	SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster OX=7227 GN=Etl1 PE=1 SV=1
9	PDB:7epuB	0.203	0.391	4.456E-34	748	0.144	0.330	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
10	PDB:6tdaS	0.246	0.523	8.368E-34	783	0.132	0.287	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
11	PDB:6uxwA	0.250	0.531	1.066E-33	778	0.143	0.314	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
12	AFDB:A0A0P0WGX7	0.254	0.424	1.810E-33	987	0.135	0.234	A0A0P0WGX7.pdb.gz	ENL1_ORYSJ SNF2 domain-containing protein ENL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENL1 PE=2 SV=1
13	PDB:6kw3Y	0.253	0.746	1.357E-31	548	0.136	0.423	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	PDB:7oo3b	0.244	0.716	3.092E-31	534	0.099	0.318	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
15	PDB:6gejM	0.239	0.575	7.049E-31	688	0.113	0.281	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	AFDB:Q9GQN5	0.255	0.327	1.008E-27	1311	0.146	0.190	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
17	PDB:5vvrM	0.223	0.678	2.361E-26	503	0.098	0.332	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
18	AFDB:F4IDQ6	0.141	0.152	1.782E-9	1576	0.103	0.112	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
19	AFDB:Q381X2	0.155	0.185	3.037E-9	1408	0.103	0.125	Q381X2.pdb.gz	Q381X2_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6260 PE=4 SV=1
20	AFDB:Q9FNM7	0.175	0.330	9.257E-9	850	0.073	0.146	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IR86	0.0	1744	1799	0.556	0.529	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
2	E9PZM4	0.0	1826	1827	0.598	0.560	CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Chd2 PE=1 SV=1
3	F4IV99	0.0	801	1724	0.328	0.325	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
4	O14139	0.0	754	1388	0.273	0.336	HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp3 PE=1 SV=1
5	O14646	0.0	3532	1710	1.000	1.000	CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1 PE=1 SV=2
6	O14647	0.0	1841	1828	0.596	0.557	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
7	P32657	0.0	729	1468	0.289	0.337	CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHD1 PE=1 SV=1
8	P40201	0.0	3014	1711	0.950	0.949	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
9	Q54Q16	0.0	830	1917	0.289	0.258	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
10	Q7KU24	0.0	1385	1883	0.429	0.389	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
11	Q9US25	0.0	727	1373	0.258	0.322	HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp1 PE=1 SV=1
12	Q9S775	4.80e-169	552	1384	0.222	0.274	PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana OX=3702 GN=PKL PE=1 SV=1
13	F7C528	1.16e-165	553	1886	0.209	0.189	F7C528_MOUSE DNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
14	Q12873	1.27e-165	555	2000	0.193	0.165	CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 PE=1 SV=3
15	E9Q614	5.16e-165	553	2021	0.209	0.177	E9Q614_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
16	B1AR17	6.18e-165	554	2055	0.193	0.161	B1AR17_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
17	Q1LYP4	6.85e-164	549	1929	0.205	0.182	Q1LYP4_DANRE DNA helicase OS=Danio rerio OX=7955 GN=im:7143343 PE=1 SV=1
18	D3ZD32	1.28e-162	546	1948	0.178	0.157	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
19	A0A2R8Y8C1	1.49e-162	540	1669	0.192	0.197	A0A2R8Y8C1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
20	A2A8L1	2.76e-162	545	1946	0.197	0.173	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18375 CDH1_2_SANT_HL1	1.4e-25	101.1	CDH1/2 SANT-Helical linker 1
2	PF00385 Chromo	1.4e-26	103.5	Chromo (CHRromatin Organisation MOdifier) domain
3	PF13907 DUF4208	5.3e-24	95.8	Domain of unknown function (DUF4208)
4	PF00271 Helicase_C	2.1e-16	71.6	Helicase conserved C-terminal domain
5	PF04851 ResIII	0.00045	31.8	Type III restriction enzyme, res subunit
6	PF00176 SNF2-rel_dom	3.9e-69	244.6	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374280	0.997	RNA polymerase-associated protein RTF1 homolog
2	9606.ENSP00000278412	0.993	FACT complex subunit SSRP1
3	9606.ENSP00000476960	0.993	Histone cluster 2 H3 pseudogene 2
4	9606.ENSP00000216297	0.967	FACT complex subunit SPT16
5	9606.ENSP00000480826	0.954	Histone cluster 1 H3 family member a
6	9606.ENSP00000319104	0.952	Transcription elongation factor SPT6
7	9606.ENSP00000254810	0.921	H3 histone, family 3B (H3.3B)
8	9606.ENSP00000307208	0.915	Nucleosome-remodeling factor subunit BPTF
9	9606.ENSP00000399797	0.912	Putative helicase MOV-10
10	9606.ENSP00000362300	0.910	Protein argonaute-1
11	9606.ENSP00000220592	0.909	Protein argonaute-2
12	9606.ENSP00000366999	0.909	Histone cluster 1 H3 family member d
13	9606.ENSP00000401946	0.909	Trinucleotide repeat-containing gene 6B protein
14	9606.ENSP00000482271	0.909	Histone cluster 1 H3 family member e
15	9606.ENSP00000484658	0.909	Histone cluster 1 H3 family member c
16	9606.ENSP00000362306	0.908	Protein argonaute-4
17	9606.ENSP00000362287	0.907	Protein argonaute-3
18	9606.ENSP00000225504	0.906	Transcription elongation factor SPT4
19	9606.ENSP00000355013	0.905	RNA polymerase-associated protein CTR9 homolog
20	9606.ENSP00000355778	0.905	Histone H3.3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.998	methylated histone binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0003676	0.993	nucleic acid binding
GO:0003824	0.992	catalytic activity
GO:0140657	0.965	ATP-dependent activity
GO:0003677	0.964	DNA binding
GO:0140640	0.947	catalytic activity, acting on a nucleic acid
GO:0140097	0.937	catalytic activity, acting on DNA
GO:0008094	0.921	ATP-dependent activity, acting on DNA
GO:0003682	0.904	chromatin binding
GO:0140658	0.553	ATP-dependent chromatin remodeler activity
GO:0003723	0.478	RNA binding
GO:0043565	0.327	sequence-specific DNA binding
GO:0003690	0.325	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.986	cellular component organization or biogenesis
GO:0016043	0.980	cellular component organization
GO:0006325	0.969	chromatin organization
GO:0006338	0.940	chromatin remodeling
GO:0008152	0.520	metabolic process
GO:0065007	0.515	biological regulation
GO:0050789	0.514	regulation of biological process
GO:0071704	0.495	organic substance metabolic process
GO:0060255	0.477	regulation of macromolecule metabolic process
GO:0043170	0.427	macromolecule metabolic process
GO:0050794	0.391	regulation of cellular process
GO:0010468	0.380	regulation of gene expression
GO:0006807	0.368	nitrogen compound metabolic process
GO:0080090	0.352	regulation of primary metabolic process
GO:0051171	0.352	regulation of nitrogen compound metabolic process
GO:0031323	0.343	regulation of cellular metabolic process
GO:0044238	0.322	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043228	0.985	non-membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005737	0.949	cytoplasm
GO:0032991	0.891	protein-containing complex
GO:0005694	0.870	chromosome
GO:0000785	0.432	chromatin
GO:0000228	0.414	nuclear chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]