StarFunc result for job id O14647

User Input

>input (1828 residues)
MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESS
ESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPS
RFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRP
VPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEAPKRQTRRRAAKNVSYKEDDDFET
DSDDLIEMTGEGVDEQQDNSETIEKVLDSRLGKKGATGASTTVYAIEANGDPSGDFDTEK
DEGEIQYLIKWKGWSYIHSTWESEESLQQQKVKGLKKLENFKKKEDEIKQWLGKVSPEDV
EYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGL
PYSECSWEDEALIGKKFQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGE
NLELRDYQLEGLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVV
PLSTLTSWQREFEIWAPEINVVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILL
KDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLL
HFIMPEKFEFWEDFEEDHGKGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVE
MSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKPPEENERENGQ
EILLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGS
IKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQAR
AHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNS
NPFNKEELTAILKFGAEDLFKELEGEESEPQEMDIDEILRLAETRENEVSTSATDELLSQ
FKVANFATMEDEEELEERPHKDWDEIIPEEQRKKVEEEERQKELEEIYMLPRIRSSTKKA
QTNDSDSDTESKRQAQRSSASESETEDSDDDKKPKRRGRPRSVRKDLVEGFTDAEIRRFI
KAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKENASEGK
GPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVE
WGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRADYLLKL
LRKGLEKKGAVTGGEEAKLKKRKPRVKKENKVPRLKEEHGIELSSPRHSDNPSEEGEVKD
DGLEKSPMKKKQKKKENKENKEKQMSSRKDKEGDKERKKSKDKKEKPKSGDAKSSSKSKR
SQGPVHITAGSEPVPIGEDEDDDLDQETFSICKERMRPVKKALKQLDKPDKGLNVQEQLE
HTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKFTEFDARKLHKLYKMAHKKRS
QEEEEQKKKDDVTGGKKPFRPEASGSSRDSLISQSHTSHNLHPQKPHLPASHGPQMHGHP
RDNYNHPNKRHFSNADRGDWQRERKFNYGGGNNNPPWGSDRHHQYEQHWYKDHHYGDRRH
MDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQD
FRRMSDHRPAMGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSK
SPLDHRSPLERSLEQKNNPDYNWNVRKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14647	1.000	1.000	0.000	1828	1.000	1.000	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
2	AFDB:P40201	0.566	0.604	0.000	1711	0.568	0.607	P40201.pdb.gz	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
3	AFDB:Q7KU24	0.586	0.570	0.000	1883	0.454	0.441	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
4	AFDB:Q9S775	0.387	0.502	1.106E-72	1384	0.216	0.285	Q9S775.pdb.gz	PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana OX=3702 GN=PKL PE=1 SV=1
5	AFDB:F4KBP5	0.322	0.267	3.161E-64	2223	0.250	0.206	F4KBP5.pdb.gz	CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana OX=3702 GN=CHR4 PE=2 SV=1
6	PDB:6g0lM	0.365	0.743	3.051E-58	855	0.207	0.443	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
7	PDB:6g0lW	0.389	0.770	3.588E-56	878	0.210	0.437	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
8	AFDB:Q6EVK6	0.251	0.210	3.213E-44	2193	0.196	0.163	Q6EVK6.pdb.gz	BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana OX=3702 GN=BRM PE=1 SV=1
9	PDB:6jylK	0.242	0.853	1.578E-42	504	0.130	0.472	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
10	PDB:6tdaS	0.235	0.534	8.139E-36	783	0.119	0.278	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
11	PDB:7epuB	0.179	0.355	3.856E-35	748	0.130	0.317	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
12	PDB:7oo3b	0.233	0.733	1.504E-33	534	0.098	0.335	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
13	PDB:6uxwA	0.238	0.544	3.711E-33	778	0.120	0.283	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
14	AFDB:P38086	0.236	0.433	4.402E-33	958	0.108	0.206	P38086.pdb.gz	RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RDH54 PE=1 SV=4
15	PDB:6kw3Y	0.238	0.747	5.044E-32	548	0.126	0.420	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:6gejM	0.225	0.579	6.816E-32	688	0.109	0.291	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:5vvrM	0.216	0.700	4.224E-28	503	0.091	0.330	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
18	AFDB:Q9U7E0	0.219	0.291	1.869E-25	1359	0.116	0.156	Q9U7E0.pdb.gz	ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans OX=6239 GN=xnp-1 PE=1 SV=1
19	AFDB:Q9M658	0.129	0.118	2.120E-12	2001	0.095	0.086	Q9M658.pdb.gz	MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana OX=3702 GN=MOM1 PE=1 SV=1
20	AFDB:F4IDQ6	0.128	0.147	8.314E-10	1576	0.120	0.139	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IR86	0.0	2289	1799	0.683	0.694	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
2	E9PZM4	0.0	3650	1827	0.964	0.965	CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Chd2 PE=1 SV=1
3	F4IV99	0.0	826	1724	0.283	0.300	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
4	O14139	0.0	762	1388	0.282	0.372	HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp3 PE=1 SV=1
5	O14646	0.0	1803	1710	0.545	0.583	CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1 PE=1 SV=2
6	O14647	0.0	3770	1828	1.000	1.000	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
7	P32657	0.0	717	1468	0.266	0.331	CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHD1 PE=1 SV=1
8	P40201	0.0	1808	1711	0.550	0.587	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
9	Q54Q16	0.0	860	1917	0.268	0.256	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
10	Q7KU24	0.0	1299	1883	0.359	0.349	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
11	Q9US25	0.0	741	1373	0.243	0.323	HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp1 PE=1 SV=1
12	Q9S775	1.36e-172	564	1384	0.206	0.272	PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana OX=3702 GN=PKL PE=1 SV=1
13	Q1LYP4	2.86e-170	569	1929	0.202	0.192	Q1LYP4_DANRE DNA helicase OS=Danio rerio OX=7955 GN=im:7143343 PE=1 SV=1
14	O16102	3.83e-169	540	892	0.176	0.361	CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster OX=7227 GN=Chd3 PE=1 SV=3
15	F7C528	3.36e-165	554	1886	0.178	0.172	F7C528_MOUSE DNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
16	Q12873	5.60e-165	555	2000	0.178	0.163	CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 PE=1 SV=3
17	B1AR17	1.07e-164	555	2055	0.178	0.158	B1AR17_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
18	E9Q614	1.74e-164	555	2021	0.178	0.161	E9Q614_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
19	A0A2R8Y5J0	4.60e-164	551	1892	0.207	0.200	A0A2R8Y5J0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
20	O97159	5.44e-164	552	1982	0.173	0.160	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18375 CDH1_2_SANT_HL1	2.8e-28	109.8	CDH1/2 SANT-Helical linker 1
2	PF00385 Chromo	1.1e-28	110.2	Chromo (CHRromatin Organisation MOdifier) domain
3	PF13907 DUF4208	1.9e-21	87.7	Domain of unknown function (DUF4208)
4	PF00271 Helicase_C	3.6e-16	70.9	Helicase conserved C-terminal domain
5	PF04851 ResIII	5.5e-05	34.7	Type III restriction enzyme, res subunit
6	PF00176 SNF2-rel_dom	1.2e-68	243.0	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377747

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216297	0.858	FACT complex subunit SPT16
2	9606.ENSP00000278412	0.851	FACT complex subunit SSRP1
3	9606.ENSP00000319104	0.845	Transcription elongation factor SPT6
4	9606.ENSP00000299601	0.822	RNA polymerase-associated protein LEO1
5	9606.ENSP00000355013	0.816	RNA polymerase-associated protein CTR9 homolog
6	9606.ENSP00000307208	0.802	Nucleosome-remodeling factor subunit BPTF
7	9606.ENSP00000225504	0.770	Transcription elongation factor SPT4
8	9606.ENSP00000295321	0.752	Protein IWS1 homolog
9	9606.ENSP00000221265	0.708	RNA polymerase II-associated factor 1 homolog
10	9606.ENSP00000335392	0.696	Spermatogenesis-associated protein 12
11	9606.ENSP00000216277	0.694	Poly(A) polymerase alpha
12	9606.ENSP00000353826	0.688	Lon protease homolog, mitochondrial
13	9606.ENSP00000288466	0.680	Zinc finger protein 618
14	9606.ENSP00000365042	0.655	Casein kinase II subunit beta
15	9606.ENSP00000428426	0.655	Transcription elongation factor A protein 1
16	9606.ENSP00000343515	0.645	Transcription elongation factor A protein 2
17	9606.ENSP00000367727	0.640	Pantothenate kinase 4
18	9606.ENSP00000386759	0.640	Histone-lysine N-methyltransferase SETD2
19	9606.ENSP00000283131	0.626	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
20	9606.ENSP00000360162	0.620	Probable global transcription activator SNF2L1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0003723	0.995	RNA binding
GO:0003824	0.850	catalytic activity
GO:0003682	0.736	chromatin binding
GO:0042393	0.564	histone binding
GO:0140097	0.390	catalytic activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.905	organic substance metabolic process
GO:0032502	0.869	developmental process
GO:0071840	0.836	cellular component organization or biogenesis
GO:0016043	0.819	cellular component organization
GO:0043170	0.809	macromolecule metabolic process
GO:0044238	0.774	primary metabolic process
GO:0048856	0.741	anatomical structure development
GO:0006807	0.724	nitrogen compound metabolic process
GO:0006325	0.706	chromatin organization
GO:0050789	0.613	regulation of biological process
GO:0050794	0.598	regulation of cellular process
GO:0006338	0.540	chromatin remodeling
GO:0019222	0.487	regulation of metabolic process
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0044237	0.469	cellular metabolic process
GO:0050896	0.394	response to stimulus
GO:0080090	0.394	regulation of primary metabolic process
GO:0051171	0.387	regulation of nitrogen compound metabolic process
GO:0031323	0.387	regulation of cellular metabolic process
GO:0048518	0.334	positive regulation of biological process
GO:0019219	0.327	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.304	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.992	nucleoplasm
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005694	0.810	chromosome
GO:0005737	0.718	cytoplasm
GO:0032991	0.677	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]