StarFunc result for job id O14653

User Input

>input (212 residues)
MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPP
NKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPM
DESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14653	1.000	1.000	5.996E-27	212	1.000	1.000	O14653.pdb.gz	GOSR2_HUMAN Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2
2	AFDB:O35166	0.747	0.747	1.643E-23	212	0.882	0.882	O35166.pdb.gz	GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus OX=10090 GN=Gosr2 PE=1 SV=2
3	AFDB:Q9VRL2	0.555	0.545	2.520E-13	216	0.415	0.407	Q9VRL2.pdb.gz	GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster OX=7227 GN=Membrin PE=2 SV=1
4	AFDB:Q9P7G5	0.488	0.443	3.258E-7	235	0.250	0.226	Q9P7G5.pdb.gz	BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bos1 PE=3 SV=1
5	AFDB:Q9FK28	0.516	0.503	4.367E-7	219	0.241	0.233	Q9FK28.pdb.gz	MEM12_ARATH Membrin-12 OS=Arabidopsis thaliana OX=3702 GN=MEMB12 PE=2 SV=1
6	AFDB:Q9SEL6	0.527	0.508	5.435E-6	221	0.156	0.149	Q9SEL6.pdb.gz	VTI11_ARATH Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana OX=3702 GN=VTI11 PE=1 SV=2
7	AFDB:Q9LVP9	0.476	0.459	6.480E-6	221	0.175	0.167	Q9LVP9.pdb.gz	VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana OX=3702 GN=VTI13 PE=2 SV=1
8	AFDB:P25385	0.359	0.318	2.094E-5	244	0.212	0.184	P25385.pdb.gz	BOS1_YEAST Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOS1 PE=1 SV=1
9	AFDB:Q9SEL5	0.412	0.394	5.349E-5	222	0.127	0.122	Q9SEL5.pdb.gz	VTI12_ARATH Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana OX=3702 GN=VTI12 PE=1 SV=3
10	AFDB:P78768	0.478	0.473	7.172E-5	214	0.179	0.178	P78768.pdb.gz	VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vti1 PE=2 SV=2
11	PDB:3c98B	0.345	0.325	3.732E-2	230	0.104	0.096	3c98B.pdb.gz
12	PDB:7q83D	0.275	0.369	1.524E-1	156	0.052	0.071	7q83D.pdb.gz
13	PDB:2jmhA	0.334	0.548	2.584E-1	117	0.052	0.094	2jmhA.pdb.gz
14	PDB:7k98A	0.243	0.168	3.895E-1	343	0.075	0.047	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
15	PDB:1serB	0.196	0.109	4.645E-1	421	0.090	0.045	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
16	PDB:3euhB	0.169	0.119	6.227E-1	321	0.118	0.078	3euhB.pdb.gz
17	PDB:7n6g3I	0.289	0.163	7.002E-1	401	0.108	0.057	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
18	PDB:5m6sA	0.268	0.484	8.348E-1	98	0.038	0.082	5m6sA.pdb.gz
19	PDB:4yhjA	0.171	0.081	8.852E-1	501	0.085	0.036	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
20	PDB:4k1nA	0.248	0.112	9.387E-1	520	0.061	0.025	4k1nA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14653	2.52e-157	435	212	1.000	1.000	GOSR2_HUMAN Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2
2	O35165	4.81e-143	399	212	0.910	0.910	GOSR2_RAT Golgi SNAP receptor complex member 2 OS=Rattus norvegicus OX=10116 GN=Gosr2 PE=1 SV=2
3	O35166	3.22e-136	382	212	0.882	0.882	GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus OX=10090 GN=Gosr2 PE=1 SV=2
4	Q9VRL2	2.10e-46	154	216	0.415	0.407	GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster OX=7227 GN=Membrin PE=2 SV=1
5	Q9FK28	1.44e-14	71.6	219	0.198	0.192	MEM12_ARATH Membrin-12 OS=Arabidopsis thaliana OX=3702 GN=MEMB12 PE=2 SV=1
6	Q9P7G5	8.07e-12	64.3	235	0.269	0.243	BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bos1 PE=3 SV=1
7	Q387W3	1.04e-04	44.3	237	0.132	0.118	Q387W3_TRYB2 SNARE protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0870 PE=4 SV=1
8	Q8IIP9	0.003	40.0	289	0.118	0.087	Q8IIP9_PLAF7 Protein transport protein BOS1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1111300 PE=4 SV=1
9	Q99JV5	0.27	33.9	224	0.179	0.170	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
10	E9PMC9	1.0	32.7	1224	0.113	0.020	E9PMC9_HUMAN EMSY transcriptional repressor, BRCA2 interacting OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=1
11	Q7Z589	1.0	32.7	1322	0.113	0.018	EMSY_HUMAN BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=2
12	Q9ZUB9	1.1	32.3	350	0.090	0.054	FB17_ARATH Putative F-box protein At1g23770 OS=Arabidopsis thaliana OX=3702 GN=At1g23770 PE=4 SV=1
13	Q9USR5	3.1	30.8	200	0.052	0.055	THOC5_SCHPO THO complex subunit tho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tho5 PE=3 SV=1
14	Q8BMB0	3.9	30.8	1264	0.108	0.018	EMSY_MOUSE BRCA2-interacting transcriptional repressor EMSY OS=Mus musculus OX=10090 GN=Emsy PE=1 SV=2
15	Q9W111	4.1	30.8	1253	0.146	0.025	Q9W111_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform A OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=2
16	Q8WQ61	4.6	30.8	1253	0.146	0.025	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
17	Q10199	6.1	30.4	670	0.132	0.042	IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp2 PE=1 SV=1
18	P25385	7.1	29.6	244	0.113	0.098	BOS1_YEAST Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOS1 PE=1 SV=1
19	Q57YC6	7.3	30.0	5290	0.075	0.003	Q57YC6_TRYB2 Dynein heavy chain, cytosolic, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.140 PE=4 SV=1
20	F4K6M8	8.1	29.6	540	0.080	0.031	F4K6M8_ARATH Calreticulin family protein OS=Arabidopsis thaliana OX=3702 GN=At5g07340 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07299 EF-G-binding_N	4e+02	12.9	Elongation factor G-binding protein, N-terminal
2	PF09124 Endonuc-dimeris	2.7e+02	13.1	T4 recombination endonuclease VII, dimerisation
3	PF06160 EzrA	1.4e+02	12.1	Septation ring formation regulator, EzrA
4	PF19191 HEF_HK	2e+02	13.9	HEF_HK domain
5	PF03908 Sec20	0.054	24.7	Sec20
6	PF15341 SLX9	92	14.8	Ribosome biogenesis protein SLX9
7	PF05008 V-SNARE	22	16.8	Vesicle transport v-SNARE protein N-terminus
8	PF12352 V-SNARE_C	2.7e-09	48.5	Snare region anchored in the vesicle membrane C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000009315

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000003630	0.998	Syntaxin 5
2	9601.ENSPPYP00000001115	0.994	Vesicle-trafficking protein SEC22b
3	9601.ENSPPYP00000022353	0.989	Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex (By similarity)
4	9601.ENSPPYP00000024128	0.972	Bet1 golgi vesicular membrane trafficking protein
5	9601.ENSPPYP00000006502	0.956	Sec1 family domain containing 1
6	9601.ENSPPYP00000015071	0.933	SEC22 vesicle trafficking protein homolog A (S. cerevisiae)
7	9601.ENSPPYP00000023774	0.928	SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
8	9601.ENSPPYP00000009145	0.911	Golgi SNAP receptor complex member 1
9	9601.ENSPPYP00000000510	0.904	Involved in intracellular vesicle trafficking
10	9601.ENSPPYP00000016579	0.892	USO1 vesicle transport factor
11	9601.ENSPPYP00000019721	0.886	Uncharacterized protein
12	9601.ENSPPYP00000011381	0.858	N-ethylmaleimide-sensitive factor attachment protein, alpha
13	9601.ENSPPYP00000000146	0.852	ADP-ribosylation factor 1
14	9601.ENSPPYP00000012031	0.845	Uncharacterized protein DKFZp459O1811
15	9601.ENSPPYP00000001911	0.844	SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro) (By similarity). Through complex formation with GRIP1, GRIA2 and NSG1 controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting (By similarity)
16	9601.ENSPPYP00000009318	0.839	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling (By similarity)
17	9601.ENSPPYP00000006039	0.835	Component of oligomeric golgi complex 6
18	9601.ENSPPYP00000010633	0.815	May play a role in vesicular transport from endoplasmic reticulum to Golgi
19	9601.ENSPPYP00000009330	0.797	Uncharacterized protein
20	9601.ENSPPYP00000021787	0.797	Syntaxin 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016192	0.997	vesicle-mediated transport
GO:0048193	0.915	Golgi vesicle transport
GO:0006891	0.480	intra-Golgi vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031090	0.997	organelle membrane
GO:0032991	0.992	protein-containing complex
GO:0005794	0.983	Golgi apparatus
GO:0098588	0.963	bounding membrane of organelle
GO:0042175	0.959	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005783	0.938	endoplasmic reticulum
GO:0031984	0.936	organelle subcompartment
GO:0000139	0.907	Golgi membrane
GO:0098827	0.882	endoplasmic reticulum subcompartment
GO:0031982	0.861	vesicle
GO:0005789	0.856	endoplasmic reticulum membrane
GO:0098796	0.830	membrane protein complex
GO:0031410	0.825	cytoplasmic vesicle
GO:0030659	0.769	cytoplasmic vesicle membrane
GO:0030135	0.654	coated vesicle
GO:0030133	0.651	transport vesicle
GO:0030662	0.590	coated vesicle membrane
GO:0030134	0.543	COPII-coated ER to Golgi transport vesicle
GO:0012507	0.476	ER to Golgi transport vesicle membrane
GO:0033116	0.444	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0005829	0.357	cytosol
GO:0071944	0.310	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]