StarFunc result for job id O14654

User Input

>input (1257 residues)
MASCSFTRDQATRRLRGAAAAAAAALAAVVTTPLLSSGTPTALIGTGSSCPGAMWLSTAT
GSRSDSESEEEDLPVGEEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAIPPLIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTLGAQPDGEPAALAAAAAAEPPFYKDVWQVIVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSARRH
LGLVPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLFTRRFVTPSEPVAHSRRGRLHLPRGR
RSRRAVSVPASFFRRLAPSPARPRHPAEAPNNGARLSSEVSGSGSGNFGEEGNPQGKEDQ
EGSGGDYMPMNNWGSGNGRGSGGGQGSNGQGSSSHSSGGNQCSGEGQGSRGGQGSNGQGS
GGNQCSRDGQGTAGGHGSGGGQRPGGGHGSGGGQGPGDGHGSGGGKNSGGGKGSGSGKGS
DGDGERGKSLKKRSYFGKLTQSKQQQMPPPPPPPPPPPPAGGTGGKGKSGGRFRLYFCVD
RGATKECKEAKEVKDAEIPEGAARGPHRARAFDEDEDDPYVPMRPGVATPLVSSSDYMPM
APQNVSASKKRHSRSPFEDSRGYMMMFPRVSPPPAPSPPKAPDTNKEDDSKDNDSESDYM
FMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFRSSPLGQNDNSEYVPMLPGKFLGRG
LDKEVSYNWDPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYK
IKPKPQKPTHEQREADSSSDYVNMDFTKRESNTPAPSTQGLPDSWGIIAEPRQSAFSNYV
NVEFGVPFPNPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVI
FNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQ
ERRRPQSRSQSFFAAARAAVSAFPTDSLERDLSPSSAPAVASAAEPTLALSQVVAAASAL
AAAPGIGAAAAAAGFDSASARWFQPVANAADAEAVRGAQDVAGGSNPGAHNPSANLARGD
NQAGGAAAAAAAPEPPPRSRRVPRPPEREDSDNDDDTHVRMDFARRDNQFDSPKRGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14654	0.999	0.999	0.000	1257	1.000	1.000	O14654.pdb.gz	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
2	AFDB:Q9Z0Y7	0.282	0.290	0.000	1216	0.766	0.792	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
3	AFDB:Q9DF49	0.185	0.214	1.951E-42	1074	0.275	0.322	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
4	AFDB:P35568	0.190	0.192	3.367E-35	1242	0.262	0.265	P35568.pdb.gz	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
5	AFDB:F1MAL5	0.198	0.188	6.294E-35	1327	0.283	0.268	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
6	AFDB:E7F4P8	0.188	0.213	1.854E-34	1099	0.248	0.284	E7F4P8.pdb.gz	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
7	AFDB:Q9Y4H2	0.184	0.174	3.275E-34	1338	0.263	0.247	Q9Y4H2.pdb.gz	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
8	AFDB:Q91615	0.055	0.075	3.067E-9	885	0.181	0.258	Q91615.pdb.gz	IRS1A_XENLA Insulin receptor substrate 1-A OS=Xenopus laevis OX=8355 GN=irs1-a PE=1 SV=1
9	PDB:3ljuX	0.113	0.294	2.637E-5	373	0.025	0.083	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
10	PDB:3pvuA	0.078	0.157	5.524E-5	609	0.024	0.049	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
11	PDB:7c3mA	0.068	0.138	8.226E-5	577	0.029	0.064	7c3mA.pdb.gz
12	PDB:4mk0A	0.078	0.152	1.296E-4	631	0.022	0.044	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
13	AFDB:Q07436	0.075	0.068	4.718E-4	1427	0.130	0.114	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
14	PDB:3uzsA	0.079	0.157	5.374E-4	609	0.024	0.049	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
15	AFDB:A8DZ19	0.083	0.080	1.172E-3	1310	0.122	0.117	A8DZ19.pdb.gz	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
16	PDB:6xtbE	0.072	0.301	1.191E-3	235	0.022	0.119	6xtbE.pdb.gz
17	PDB:6s9wA	0.075	0.205	2.358E-3	411	0.024	0.073	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:6bbpA	0.064	0.152	2.796E-3	520	0.019	0.046	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:7nkyQ	0.095	0.211	3.133E-3	404	0.025	0.077	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:6r9tA	0.080	0.048	4.665E-3	2185	0.024	0.014	6r9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14654	0.0	2550	1257	1.000	1.000	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
2	Q9Z0Y7	0.0	703	1216	0.333	0.344	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
3	Q9DF49	7.69e-90	317	1074	0.140	0.164	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
4	Q7ZU74	2.97e-78	282	1032	0.121	0.147	Q7ZU74_DANRE Insulin receptor substrate 2 OS=Danio rerio OX=7955 GN=irs2a PE=2 SV=1
5	E7F4P8	4.93e-76	276	1099	0.119	0.136	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
6	P35570	1.38e-75	276	1235	0.132	0.134	IRS1_RAT Insulin receptor substrate 1 OS=Rattus norvegicus OX=10116 GN=Irs1 PE=1 SV=1
7	P35569	6.53e-75	275	1233	0.132	0.135	IRS1_MOUSE Insulin receptor substrate 1 OS=Mus musculus OX=10090 GN=Irs1 PE=1 SV=1
8	P35568	2.90e-73	270	1242	0.132	0.134	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
9	P81122	1.23e-70	262	1321	0.119	0.114	IRS2_MOUSE Insulin receptor substrate 2 OS=Mus musculus OX=10090 GN=Irs2 PE=1 SV=2
10	Q9Y4H2	1.11e-69	259	1338	0.120	0.113	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
11	F1MAL5	1.40e-69	258	1327	0.115	0.109	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
12	B1WBQ1	4.13e-42	164	494	0.080	0.204	B1WBQ1_RAT Insulin receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Irs3 PE=4 SV=1
13	O08724	4.50e-42	164	494	0.080	0.204	O08724_RAT Insulin receptor substrate-3 OS=Rattus norvegicus OX=10116 GN=Irs3 PE=2 SV=1
14	Q4QQK2	6.79e-40	154	362	0.080	0.279	Q4QQK2_MOUSE Insulin receptor substrate 3 OS=Mus musculus OX=10090 GN=Irs3 PE=2 SV=1
15	O54718	8.04e-39	154	495	0.079	0.200	O54718_MOUSE Insulin receptor substrate-3 (Fragment) OS=Mus musculus OX=10090 GN=Irs3 PE=2 SV=1
16	Q9XTN2	2.28e-35	148	968	0.071	0.092	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
17	Q91615	9.93e-22	104	885	0.060	0.086	IRS1A_XENLA Insulin receptor substrate 1-A OS=Xenopus laevis OX=8355 GN=irs1-a PE=1 SV=1
18	Q584T3	0.069	40.0	775	0.027	0.044	Q584T3_TRYB2 Mitochondrial oligo U binding protein TBRGG1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.600 PE=4 SV=1
19	G8B4T8	0.16	38.9	1429	0.053	0.046	G8B4T8_CANPC Hyphally-regulated cell wall protein N-terminal domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=HYR31 PE=4 SV=1
20	O70360	0.29	37.4	332	0.019	0.072	O70360_RAT Insulin receptor substrate 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=IRS-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	3.9e-26	102.1	PTB domain (IRS-1 type)
2	PF15413 PH_11	7.8	18.4	Pleckstrin homology domain
3	PF15409 PH_8	72	15.1	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.979	Growth factor receptor-bound protein 2
2	9606.ENSP00000300574	0.947	Adapter molecule crk
3	9606.ENSP00000268035	0.932	Insulin-like growth factor 1 receptor
4	9606.ENSP00000304895	0.932	Insulin receptor substrate 1
5	9606.ENSP00000365016	0.932	Insulin receptor substrate 2
6	9606.ENSP00000428056	0.921	Phosphatidylinositol 3-kinase regulatory subunit alpha
7	9606.ENSP00000303830	0.914	Insulin receptor
8	9606.ENSP00000380432	0.913	Insulin
9	9606.ENSP00000352121	0.884	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
10	9606.ENSP00000367830	0.873	Protein kinase C zeta type
11	9606.ENSP00000378217	0.864	Protein kinase C delta type
12	9606.ENSP00000302665	0.858	Insulin-like growth factor I
13	9606.ENSP00000354558	0.857	Serine/threonine-protein kinase mTOR
14	9606.ENSP00000378857	0.854	WD repeat-containing protein 6
15	9606.ENSP00000392812	0.852	Phosphoinositide 3-kinase regulatory subunit 5
16	9606.ENSP00000442460	0.851	Protein-tyrosine kinase 6
17	9606.ENSP00000371067	0.848	Tyrosine-protein kinase JAK2
18	9606.ENSP00000330341	0.836	Suppressor of cytokine signaling 3
19	9606.ENSP00000360683	0.836	Tyrosine-protein phosphatase non-receptor type 1
20	9606.ENSP00000222254	0.833	Phosphatidylinositol 3-kinase regulatory subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.314	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.998	response to stimulus
GO:0051716	0.988	cellular response to stimulus
GO:0023052	0.985	signaling
GO:0007154	0.979	cell communication
GO:0007165	0.953	signal transduction
GO:0048518	0.603	positive regulation of biological process
GO:0048522	0.524	positive regulation of cellular process
GO:0048583	0.494	regulation of response to stimulus
GO:0019222	0.432	regulation of metabolic process
GO:0023051	0.363	regulation of signaling
GO:0010646	0.363	regulation of cell communication
GO:0060255	0.356	regulation of macromolecule metabolic process
GO:0048519	0.330	negative regulation of biological process
GO:0031323	0.328	regulation of cellular metabolic process
GO:0080090	0.321	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.964	cytosol
GO:0043226	0.701	organelle
GO:0043229	0.667	intracellular organelle
GO:0043231	0.648	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]