StarFunc result for job id O14672

User Input

>input (748 residues)
MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35598	0.952	0.951	0.000	749	0.960	0.959	O35598.pdb.gz	ADA10_MOUSE Disintegrin and metalloproteinase domain-containing protein 10 OS=Mus musculus OX=10090 GN=Adam10 PE=1 SV=2
2	AFDB:Q94902	0.637	0.419	2.378E-77	1239	0.445	0.269	Q94902.pdb.gz	Q94902_DROME Kuzbanian OS=Drosophila melanogaster OX=7227 GN=kuz PE=2 SV=1
3	AFDB:G5EFD9	0.641	0.527	1.432E-73	922	0.400	0.324	G5EFD9.pdb.gz	ADA10_CAEEL Disintegrin and metalloproteinase domain-containing protein 10 homolog OS=Caenorhabditis elegans OX=6239 GN=sup-17 PE=1 SV=1
4	AFDB:Q9VAI2	0.623	0.324	5.132E-65	1537	0.408	0.198	Q9VAI2.pdb.gz	Q9VAI2_DROME Kuzbanian-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Kul PE=4 SV=1
5	AFDB:Q9Z0F8	0.439	0.400	5.370E-50	827	0.263	0.238	Q9Z0F8.pdb.gz	ADA17_MOUSE Disintegrin and metalloproteinase domain-containing protein 17 OS=Mus musculus OX=10090 GN=Adam17 PE=1 SV=3
6	AFDB:Q9VAC5	0.565	0.577	7.572E-50	732	0.255	0.261	Q9VAC5.pdb.gz	ADA17_DROME ADAM 17-like protease OS=Drosophila melanogaster OX=7227 GN=Tace PE=2 SV=2
7	AFDB:Q94316	0.435	0.472	3.496E-43	686	0.211	0.230	Q94316.pdb.gz	ADA17_CAEEL Disintegrin and metalloproteinase domain-containing protein 17 homolog OS=Caenorhabditis elegans OX=6239 GN=adm-4 PE=3 SV=1
8	AFDB:Q10749	0.381	0.458	2.758E-33	609	0.191	0.235	Q10749.pdb.gz	VM3M1_NAJMO Snake venom metalloproteinase-disintegrin-like mocarhagin OS=Naja mossambica OX=8644 PE=1 SV=3
9	AFDB:Q7ZYZ9	0.380	0.342	3.673E-33	843	0.215	0.191	Q7ZYZ9.pdb.gz	Q7ZYZ9_DANRE A disintegrin and metalloproteinase domain 8a OS=Danio rerio OX=7955 GN=adam8 PE=2 SV=2
10	AFDB:Q4WQ08	0.393	0.377	5.666E-31	785	0.219	0.209	Q4WQ08.pdb.gz	ADMB_ASPFU Disintegrin and metalloproteinase domain-containing protein B OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ADM-B PE=3 SV=2
11	PDB:4q1lA	0.230	0.779	1.255E-9	202	0.060	0.223	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:2x7mA	0.185	0.654	2.118E-5	180	0.041	0.172	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
13	PDB:1su3B	0.153	0.259	6.496E-3	416	0.045	0.082	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
14	PDB:4axqA	0.160	0.644	1.152E-2	163	0.037	0.172	4axqA.pdb.gz	Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
15	PDB:5cslA	0.071	0.031	7.196E-2	2050	0.024	0.009	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
16	PDB:1af0A	0.144	0.215	8.544E-2	470	0.049	0.079	1af0A.pdb.gz	Kinetic characterization of the serralysins: a divergent catalytic mechanism pertaining to astacin-type metalloproteases.
17	PDB:5cslB	0.073	0.032	1.276E-1	2072	0.024	0.009	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
18	PDB:4af8A	0.082	0.143	2.017E-1	333	0.015	0.033	4af8A.pdb.gz
19	PDB:6g2hA	0.071	0.071	3.011E-1	761	0.019	0.018	6g2hA.pdb.gz
20	PDB:7e16A	0.076	0.221	3.011E-1	207	0.017	0.063	7e16A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14672	0.0	1572	748	1.000	1.000	ADA10_HUMAN Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10 PE=1 SV=1
2	O35598	0.0	1445	749	0.961	0.960	ADA10_MOUSE Disintegrin and metalloproteinase domain-containing protein 10 OS=Mus musculus OX=10090 GN=Adam10 PE=1 SV=2
3	Q10741	0.0	1529	748	0.967	0.967	ADA10_BOVIN Disintegrin and metalloproteinase domain-containing protein 10 OS=Bos taurus OX=9913 GN=ADAM10 PE=1 SV=1
4	Q10743	0.0	1448	749	0.963	0.961	ADA10_RAT Disintegrin and metalloproteinase domain-containing protein 10 OS=Rattus norvegicus OX=10116 GN=Adam10 PE=1 SV=2
5	G5EFD9	1.58e-163	498	922	0.414	0.336	ADA10_CAEEL Disintegrin and metalloproteinase domain-containing protein 10 homolog OS=Caenorhabditis elegans OX=6239 GN=sup-17 PE=1 SV=1
6	Q59DZ3	7.77e-147	459	1090	0.341	0.234	Q59DZ3_DROME FI21209p1 OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=1
7	A8DZ03	8.64e-146	458	1161	0.341	0.220	A8DZ03_DROME Kuzbanian, isoform G OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=2
8	Q94902	1.97e-145	459	1239	0.341	0.206	Q94902_DROME Kuzbanian OS=Drosophila melanogaster OX=7227 GN=kuz PE=2 SV=1
9	Q9VJW9	2.08e-145	459	1238	0.341	0.206	Q9VJW9_DROME Kuzbanian, isoform A OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=1
10	A8DZ02	2.66e-145	458	1219	0.341	0.209	A8DZ02_DROME Kuzbanian, isoform F OS=Drosophila melanogaster OX=7227 GN=kuz PE=1 SV=2
11	Q9VAI2	1.11e-143	460	1537	0.326	0.159	Q9VAI2_DROME Kuzbanian-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Kul PE=4 SV=1
12	Q9Z1K9	2.97e-71	251	827	0.259	0.235	ADA17_RAT Disintegrin and metalloproteinase domain-containing protein 17 OS=Rattus norvegicus OX=10116 GN=Adam17 PE=1 SV=1
13	Q9Z0F8	3.17e-69	245	827	0.257	0.232	ADA17_MOUSE Disintegrin and metalloproteinase domain-containing protein 17 OS=Mus musculus OX=10090 GN=Adam17 PE=1 SV=3
14	B2RNB2	1.12e-68	243	824	0.257	0.233	B2RNB2_HUMAN ADAM metallopeptidase domain 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=2 SV=1
15	P78536	1.12e-68	243	824	0.257	0.233	ADA17_HUMAN Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=1 SV=1
16	Q9VAC5	1.01e-60	219	732	0.242	0.247	ADA17_DROME ADAM 17-like protease OS=Drosophila melanogaster OX=7227 GN=Tace PE=2 SV=2
17	Q94316	1.52e-38	155	686	0.167	0.182	ADA17_CAEEL Disintegrin and metalloproteinase domain-containing protein 17 homolog OS=Caenorhabditis elegans OX=6239 GN=adm-4 PE=3 SV=1
18	Q7ZYZ9	3.26e-32	136	843	0.186	0.165	Q7ZYZ9_DANRE A disintegrin and metalloproteinase domain 8a OS=Danio rerio OX=7955 GN=adam8 PE=2 SV=2
19	Q10749	4.27e-30	128	609	0.176	0.217	VM3M1_NAJMO Snake venom metalloproteinase-disintegrin-like mocarhagin OS=Naja mossambica OX=8644 PE=1 SV=3
20	Q61072	2.18e-27	121	845	0.197	0.174	ADAM9_MOUSE Disintegrin and metalloproteinase domain-containing protein 9 OS=Mus musculus OX=10090 GN=Adam9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00200 Disintegrin	2.2e-10	52.5	Disintegrin
2	PF10462 Peptidase_M66	1e+02	13.3	Peptidase M66
3	PF01562 Pep_M12B_propep	2.8e-08	45.6	Reprolysin family propeptide
4	PF01421 Reprolysin	0.0023	29.5	Reprolysin (M12B) family zinc metalloprotease
5	PF13574 Reprolysin_2	3.3e-31	120.2	Metallo-peptidase family M12B Reprolysin-like
6	PF13582 Reprolysin_3	4.4e-27	106.4	Metallo-peptidase family M12B Reprolysin-like
7	PF13583 Reprolysin_4	8.9e-13	59.9	Metallo-peptidase family M12B Reprolysin-like
8	PF13688 Reprolysin_5	3e-29	114.1	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000013870

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010158	0.930	Notch 1
2	61853.ENSNLEP00000003308	0.904	Amyloid beta (A4) precursor protein
3	61853.ENSNLEP00000015261	0.897	Tetraspanin 33
4	61853.ENSNLEP00000000324	0.862	Delta-like protein
5	61853.ENSNLEP00000006645	0.862	Notch 2
6	61853.ENSNLEP00000004148	0.860	Delta-like protein
7	61853.ENSNLEP00000016381	0.845	ADAM metallopeptidase domain 17
8	61853.ENSNLEP00000017624	0.845	Delta-like protein
9	61853.ENSNLEP00000019913	0.841	Delta-like protein
10	61853.ENSNLEP00000016997	0.817	Tetraspanin 5
11	61853.ENSNLEP00000014272	0.816	EPH receptor A3
12	61853.ENSNLEP00000001714	0.813	ephrin-A2
13	61853.ENSNLEP00000002540	0.806	Discs, large homolog 1 (Drosophila)
14	61853.ENSNLEP00000013891	0.806	Tetraspanin 15
15	61853.ENSNLEP00000004276	0.805	Tetraspanin
16	61853.ENSNLEP00000020937	0.805	Crumbs 2, cell polarity complex component
17	61853.ENSNLEP00000021941	0.805	Crumbs 1, cell polarity complex component
18	61853.ENSNLEP00000009112	0.794	Amyloid beta (A4) precursor-like protein 2
19	61853.ENSNLEP00000020085	0.792	Pro-epidermal growth factor
20	61853.ENSNLEP00000007945	0.778	Cadherin 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004222	1.000	metalloendopeptidase activity
GO:0019899	0.783	enzyme binding
GO:0042802	0.771	identical protein binding
GO:0019900	0.598	kinase binding
GO:0016805	0.583	dipeptidase activity
GO:0019901	0.559	protein kinase binding
GO:0046983	0.548	protein dimerization activity
GO:0008235	0.540	metalloexopeptidase activity
GO:0042803	0.530	protein homodimerization activity
GO:0070573	0.307	metallodipeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0009987	0.989	cellular process
GO:0071704	0.975	organic substance metabolic process
GO:0044238	0.968	primary metabolic process
GO:0006807	0.961	nitrogen compound metabolic process
GO:0043170	0.958	macromolecule metabolic process
GO:0048518	0.951	positive regulation of biological process
GO:1901564	0.946	organonitrogen compound metabolic process
GO:0048522	0.943	positive regulation of cellular process
GO:0032501	0.936	multicellular organismal process
GO:0019538	0.936	protein metabolic process
GO:0033619	0.927	membrane protein proteolysis
GO:0048583	0.914	regulation of response to stimulus
GO:0032502	0.897	developmental process
GO:0016043	0.887	cellular component organization
GO:0051128	0.874	regulation of cellular component organization
GO:0051716	0.804	cellular response to stimulus
GO:0050793	0.792	regulation of developmental process
GO:0051604	0.783	protein maturation
GO:0040012	0.773	regulation of locomotion
GO:0030334	0.756	regulation of cell migration
GO:0042221	0.732	response to chemical
GO:0065008	0.728	regulation of biological quality
GO:0007154	0.709	cell communication
GO:0023052	0.700	signaling
GO:0048519	0.696	negative regulation of biological process
GO:0007165	0.693	signal transduction
GO:0016485	0.693	protein processing
GO:0048856	0.676	anatomical structure development
GO:0009966	0.650	regulation of signal transduction
GO:0007166	0.636	cell surface receptor signaling pathway
GO:0046931	0.599	pore complex assembly
GO:0051239	0.586	regulation of multicellular organismal process
GO:0050807	0.523	regulation of synapse organization
GO:0019222	0.468	regulation of metabolic process
GO:0043603	0.466	amide metabolic process
GO:0006518	0.452	peptide metabolic process
GO:0048523	0.432	negative regulation of cellular process
GO:0060255	0.429	regulation of macromolecule metabolic process
GO:0007275	0.425	multicellular organism development
GO:0030335	0.415	positive regulation of cell migration
GO:0099175	0.384	regulation of postsynapse organization
GO:0048584	0.383	positive regulation of response to stimulus
GO:0044237	0.341	cellular metabolic process
GO:0051179	0.314	localization
GO:0032879	0.305	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.985	cytoplasm
GO:0012505	0.973	endomembrane system
GO:0005576	0.931	extracellular region
GO:0031982	0.925	vesicle
GO:0031410	0.817	cytoplasmic vesicle
GO:0030054	0.761	cell junction
GO:0009986	0.747	cell surface
GO:0098590	0.736	plasma membrane region
GO:0045202	0.635	synapse
GO:0032991	0.560	protein-containing complex
GO:0098796	0.485	membrane protein complex
GO:0046930	0.429	pore complex
GO:0043233	0.402	organelle lumen
GO:0099503	0.387	secretory vesicle
GO:0097060	0.381	synaptic membrane
GO:0070013	0.380	intracellular organelle lumen
GO:0005634	0.380	nucleus
GO:0030312	0.364	external encapsulating structure
GO:0062023	0.338	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.13.-	0.583	Dipeptidases.

[back to server]