StarFunc result for job id O14682

User Input

>input (589 residues)
MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCH
RAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESL
LEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIR
KNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELLQTVRLAL
LPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL
GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWV
YDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT
INKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQ
PWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKL
YVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14682	1.000	1.000	0.000	589	1.000	1.000	O14682.pdb.gz	ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens OX=9606 GN=ENC1 PE=1 SV=2
2	AFDB:Q7ZT06	0.977	0.977	7.131E-99	589	0.771	0.771	Q7ZT06.pdb.gz	Q7ZT06_DANRE Ectodermal-neural cortex (With BTB-like domain) OS=Danio rerio OX=7955 GN=enc1 PE=2 SV=1
3	AFDB:Q8R2P1	0.946	0.946	1.918E-95	589	0.733	0.733	Q8R2P1.pdb.gz	KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus OX=10090 GN=Klhl25 PE=1 SV=1
4	AFDB:Q9Y2M5	0.487	0.472	1.120E-55	609	0.299	0.289	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
5	AFDB:O95198	0.697	0.693	2.775E-55	593	0.287	0.285	O95198.pdb.gz	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
6	AFDB:Q9VUU5	0.506	0.480	6.518E-55	623	0.294	0.278	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
7	AFDB:E0CZ16	0.481	0.483	1.111E-54	587	0.292	0.293	E0CZ16.pdb.gz	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
8	AFDB:Q53G59	0.489	0.506	1.163E-53	568	0.277	0.287	Q53G59.pdb.gz	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2
9	AFDB:Q6TDP4	0.498	0.463	3.761E-53	642	0.277	0.254	Q6TDP4.pdb.gz	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
10	AFDB:Q08BL9	0.534	0.526	9.828E-53	599	0.307	0.302	Q08BL9.pdb.gz	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
11	PDB:5gq0A	0.387	0.652	9.234E-16	338	0.112	0.195	5gq0A.pdb.gz
12	PDB:2uvkB	0.371	0.608	7.399E-15	349	0.083	0.140	2uvkB.pdb.gz
13	PDB:5gqtA	0.366	0.454	4.789E-14	470	0.092	0.115	5gqtA.pdb.gz
14	PDB:2zwaB	0.346	0.301	3.243E-12	683	0.076	0.066	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:6dbjD	0.334	0.514	2.536E-8	352	0.075	0.125	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
16	PDB:6wcqC	0.188	0.803	4.562E-8	130	0.059	0.269	6wcqC.pdb.gz
17	PDB:6oemB	0.328	0.510	1.556E-7	346	0.065	0.110	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
18	PDB:1n6dA	0.321	0.196	1.827E-7	1023	0.056	0.032	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
19	PDB:2hqsA	0.325	0.440	1.827E-7	412	0.059	0.085	2hqsA.pdb.gz
20	PDB:1nr0A	0.266	0.258	5.310E-7	610	0.070	0.067	1nr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14682	0.0	1233	589	1.000	1.000	ENC1_HUMAN Ectoderm-neural cortex protein 1 OS=Homo sapiens OX=9606 GN=ENC1 PE=1 SV=2
2	Q2V9T0	0.0	1226	589	0.993	0.993	Q2V9T0_RAT Ectodermal-neural cortex 1 OS=Rattus norvegicus OX=10116 GN=Enc1 PE=2 SV=1
3	Q6DKY8	0.0	1228	589	0.995	0.995	Q6DKY8_RAT Ectodermal-neural cortex 1 OS=Rattus norvegicus OX=10116 GN=Enc1 PE=4 SV=1
4	Q7ZT06	0.0	984	589	0.771	0.771	Q7ZT06_DANRE Ectodermal-neural cortex (With BTB-like domain) OS=Danio rerio OX=7955 GN=enc1 PE=2 SV=1
5	Q8R2P1	0.0	927	589	0.733	0.733	KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus OX=10090 GN=Klhl25 PE=1 SV=1
6	Q9H0H3	0.0	953	589	0.747	0.747	KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens OX=9606 GN=KLHL25 PE=1 SV=1
7	Q6TFL4	1.10e-88	288	600	0.312	0.307	KLH24_HUMAN Kelch-like protein 24 OS=Homo sapiens OX=9606 GN=KLHL24 PE=1 SV=1
8	Q9Y2M5	4.69e-84	276	609	0.301	0.291	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
9	Q08BL9	1.50e-81	269	599	0.299	0.294	KL24A_DANRE Kelch-like protein 24a OS=Danio rerio OX=7955 GN=klhl24a PE=2 SV=1
10	Q8NBE8	5.26e-81	266	558	0.280	0.296	KLH23_HUMAN Kelch-like protein 23 OS=Homo sapiens OX=9606 GN=KLHL23 PE=1 SV=1
11	Q9VUU5	4.49e-80	266	623	0.294	0.278	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
12	E0CZ16	1.82e-79	263	587	0.294	0.295	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
13	Q9UH77	5.30e-79	262	587	0.292	0.293	KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens OX=9606 GN=KLHL3 PE=1 SV=2
14	Q8JZP3	1.64e-78	261	593	0.292	0.290	KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus OX=10090 GN=Klhl2 PE=2 SV=1
15	O95198	3.99e-77	257	593	0.290	0.288	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
16	Q8K430	6.08e-77	258	640	0.273	0.252	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1
17	Q5U374	1.29e-76	255	564	0.272	0.284	KLH12_DANRE Kelch-like protein 12 OS=Danio rerio OX=7955 GN=klhl12 PE=2 SV=2
18	Q6TDP4	1.37e-76	257	642	0.275	0.252	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
19	Q2WGJ6	1.65e-75	253	581	0.294	0.298	KLH38_HUMAN Kelch-like protein 38 OS=Homo sapiens OX=9606 GN=KLHL38 PE=1 SV=3
20	Q53G59	7.38e-75	251	568	0.278	0.289	KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens OX=9606 GN=KLHL12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	6.3e-26	101.8	BTB And C-terminal Kelch
2	PF00651 BTB	1.4e-25	101.1	BTB/POZ domain
3	PF08461 HTH_12	4.8e+02	12.1	Ribonuclease R winged-helix domain
4	PF01344 Kelch_1	3.1e-44	159.6	Kelch motif
5	PF07646 Kelch_2	1.1e-14	65.0	Kelch motif
6	PF13415 Kelch_3	1.9e-14	64.8	Galactose oxidase, central domain
7	PF13418 Kelch_4	4.2e-16	69.9	Galactose oxidase, central domain
8	PF13854 Kelch_5	1.2e-07	42.7	Kelch motif
9	PF13964 Kelch_6	5.1e-18	75.9	Kelch motif
10	PF09070 PFU	73	14.9	PFU (PLAA family ubiquitin binding)
11	PF11822 SANBR_BTB	0.36	22.4	SANT and BTB domain regulator of CSR, BTB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479101

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264414	0.983	Cullin-3
2	9606.ENSP00000336800	0.966	Kelch-like protein 25
3	9606.ENSP00000171111	0.928	Kelch-like ECH-associated protein 1
4	9606.ENSP00000216225	0.927	E3 ubiquitin-protein ligase RBX1
5	9606.ENSP00000370671	0.925	Kelch-like protein 42
6	9606.ENSP00000343273	0.916	Kelch-like protein 7
7	9606.ENSP00000443191	0.916	Kelch-like protein 13
8	9606.ENSP00000351933	0.915	Kelch-like protein 9
9	9606.ENSP00000377001	0.915	Speckle-type POZ protein
10	9606.ENSP00000476795	0.914	Gigaxonin
11	9606.ENSP00000280098	0.913	Speckle-type POZ protein-like
12	9606.ENSP00000209884	0.912	Kelch-like protein 20
13	9606.ENSP00000273963	0.909	Kelch-like protein 8
14	9606.ENSP00000356230	0.909	Kelch-like protein 12
15	9606.ENSP00000312397	0.908	Kelch-like protein 3
16	9606.ENSP00000331682	0.908	Kelch-like protein 22
17	9606.ENSP00000284669	0.906	Kelch-like protein 41
18	9606.ENSP00000261416	0.904	Beta-hexosaminidase subunit beta
19	9606.ENSP00000366886	0.904	Kelch-like protein 21
20	9606.ENSP00000385096	0.903	BTB/POZ domain-containing protein KCTD17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0031346	0.941	positive regulation of cell projection organization
GO:0010975	0.938	regulation of neuron projection development
GO:0071704	0.936	organic substance metabolic process
GO:0010976	0.929	positive regulation of neuron projection development
GO:0006807	0.924	nitrogen compound metabolic process
GO:0044238	0.920	primary metabolic process
GO:0009987	0.916	cellular process
GO:0043170	0.899	macromolecule metabolic process
GO:1901564	0.858	organonitrogen compound metabolic process
GO:0019538	0.760	protein metabolic process
GO:0019222	0.600	regulation of metabolic process
GO:0044237	0.580	cellular metabolic process
GO:0016567	0.560	protein ubiquitination
GO:0051603	0.485	proteolysis involved in protein catabolic process
GO:0060255	0.469	regulation of macromolecule metabolic process
GO:0051171	0.463	regulation of nitrogen compound metabolic process
GO:0031323	0.462	regulation of cellular metabolic process
GO:0048519	0.440	negative regulation of biological process
GO:0044260	0.414	cellular macromolecule metabolic process
GO:0044248	0.390	cellular catabolic process
GO:0048856	0.356	anatomical structure development
GO:0032501	0.349	multicellular organismal process
GO:0044265	0.343	cellular macromolecule catabolic process
GO:0080090	0.337	regulation of primary metabolic process
GO:0048523	0.318	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:1902494	0.996	catalytic complex
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0031461	0.986	cullin-RING ubiquitin ligase complex
GO:0031463	0.983	Cul3-RING ubiquitin ligase complex
GO:0005737	0.977	cytoplasm
GO:0005829	0.944	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]