StarFunc result for job id O14684

User Input

>input (152 residues)
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14684	1.000	1.000	9.037E-22	152	1.000	1.000	O14684.pdb.gz	PTGES_HUMAN Prostaglandin E synthase OS=Homo sapiens OX=9606 GN=PTGES PE=1 SV=2
2	PDB:4bpmA	0.933	0.876	7.768E-19	162	0.934	0.877	4bpmA.pdb.gz	Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
3	AFDB:Q2TJZ7	0.929	0.923	1.132E-18	153	0.868	0.863	Q2TJZ7.pdb.gz	Q2TJZ7_PIG glutathione transferase OS=Sus scrofa OX=9823 GN=PTGES PE=1 SV=1
4	AFDB:Q9JHF3	0.962	0.955	4.645E-17	153	0.803	0.797	Q9JHF3.pdb.gz	PTGES_RAT Prostaglandin E synthase OS=Rattus norvegicus OX=10116 GN=Ptges PE=1 SV=1
5	AFDB:Q5IHX7	0.926	0.964	2.907E-14	146	0.592	0.616	Q5IHX7.pdb.gz	Q5IHX7_DANRE glutathione transferase OS=Danio rerio OX=7955 GN=mpges PE=2 SV=1
6	AFDB:P10620	0.895	0.878	3.382E-10	155	0.382	0.374	P10620.pdb.gz	MGST1_HUMAN Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1
7	AFDB:Q5XJJ0	0.917	0.906	3.554E-10	154	0.368	0.364	Q5XJJ0.pdb.gz	Q5XJJ0_DANRE glutathione transferase OS=Danio rerio OX=7955 GN=mgst1 PE=1 SV=1
8	AFDB:P08011	0.890	0.873	1.822E-9	155	0.368	0.361	P08011.pdb.gz	MGST1_RAT Microsomal glutathione S-transferase 1 OS=Rattus norvegicus OX=10116 GN=Mgst1 PE=1 SV=3
9	PDB:4ntaA	0.671	0.691	1.082E-3	147	0.151	0.156	4ntaA.pdb.gz
10	PDB:4jrzA	0.610	0.600	1.256E-3	155	0.171	0.168	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
11	AFDB:O14880	0.638	0.638	1.741E-3	152	0.230	0.230	O14880.pdb.gz	MGST3_HUMAN Glutathione S-transferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1
12	PDB:6sswB	0.641	0.690	2.165E-3	140	0.178	0.193	6sswB.pdb.gz	Crystal structures of human MGST2 reveal synchronized conformational changes regulating catalysis.
13	AFDB:F1QKS8	0.651	0.637	3.154E-3	156	0.191	0.186	F1QKS8.pdb.gz	F1QKS8_DANRE Arachidonate 5-lipoxygenase-activating protein OS=Danio rerio OX=7955 GN=wu:fj65d02 PE=4 SV=1
14	AFDB:Q99735	0.632	0.651	4.041E-3	147	0.184	0.190	Q99735.pdb.gz	MGST2_HUMAN Microsomal glutathione S-transferase 2 OS=Homo sapiens OX=9606 GN=MGST2 PE=1 SV=1
15	PDB:6vgcD	0.565	0.555	3.141E-2	155	0.145	0.142	6vgcD.pdb.gz	Structure-based, multi-targeted drug discovery approach to eicosanoid inhibition: Dual inhibitors of mPGES-1 and 5-lipoxygenase activating protein (FLAP).
16	PDB:7n8oQ	0.280	0.348	6.774E-1	119	0.132	0.168	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
17	PDB:3cwbC	0.260	0.127	9.118E-1	380	0.164	0.066	3cwbC.pdb.gz	The role of molecular modeling in the design of analogues of the fungicidal natural products crocacins A and D.
18	PDB:3cx5C	0.287	0.137	9.581E-1	385	0.158	0.062	3cx5C.pdb.gz	Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
19	PDB:7uw9i	0.432	0.425	1.290	156	0.112	0.109	7uw9i.pdb.gz
20	PDB:5tj5B	0.278	0.246	1.424	187	0.125	0.102	5tj5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14684	4.25e-111	313	152	1.000	1.000	PTGES_HUMAN Prostaglandin E synthase OS=Homo sapiens OX=9606 GN=PTGES PE=1 SV=2
2	Q2TJZ7	1.13e-94	272	153	0.868	0.863	Q2TJZ7_PIG glutathione transferase OS=Sus scrofa OX=9823 GN=PTGES PE=1 SV=1
3	Q95L14	4.64e-93	268	153	0.855	0.850	PTGES_BOVIN Prostaglandin E synthase OS=Bos taurus OX=9913 GN=PTGES PE=2 SV=1
4	Q9JHF3	4.18e-86	250	153	0.803	0.797	PTGES_RAT Prostaglandin E synthase OS=Rattus norvegicus OX=10116 GN=Ptges PE=1 SV=1
5	Q9JM51	2.64e-84	246	153	0.796	0.791	PTGES_MOUSE Prostaglandin E synthase OS=Mus musculus OX=10090 GN=Ptges PE=1 SV=1
6	Q5IHX7	4.92e-63	192	146	0.586	0.610	Q5IHX7_DANRE glutathione transferase OS=Danio rerio OX=7955 GN=mpges PE=2 SV=1
7	Q5XJJ0	7.88e-31	110	154	0.368	0.364	Q5XJJ0_DANRE glutathione transferase OS=Danio rerio OX=7955 GN=mgst1 PE=1 SV=1
8	P10620	3.03e-29	106	155	0.375	0.368	MGST1_HUMAN Microsomal glutathione S-transferase 1 OS=Homo sapiens OX=9606 GN=MGST1 PE=1 SV=1
9	Q91VS7	5.37e-27	100	155	0.362	0.355	MGST1_MOUSE Microsomal glutathione S-transferase 1 OS=Mus musculus OX=10090 GN=Mgst1 PE=1 SV=3
10	P08011	1.97e-26	99.4	155	0.362	0.355	MGST1_RAT Microsomal glutathione S-transferase 1 OS=Rattus norvegicus OX=10116 GN=Mgst1 PE=1 SV=3
11	O14880	0.77	31.2	152	0.151	0.151	MGST3_HUMAN Glutathione S-transferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1
12	P12388	5.6	29.3	415	0.079	0.029	PAI2_MOUSE Plasminogen activator inhibitor 2, macrophage OS=Mus musculus OX=10090 GN=Serpinb2 PE=1 SV=1
13	D4ADS4	8.6	28.5	152	0.145	0.145	D4ADS4_RAT Microsomal glutathione S-transferase 3 OS=Rattus norvegicus OX=10116 GN=Mgst3 PE=4 SV=1
14	P9WNW0	9.7	28.9	639	0.072	0.017	DNAG_MYCTO DNA primase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=dnaG PE=3 SV=1
15	P9WNW1	9.7	28.9	639	0.072	0.017	DNAG_MYCTU DNA primase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dnaG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14359 DUF4406	1.9e+02	13.8	Domain of unknown function (DUF4406)
2	PF01124 MAPEG	2.7e-22	90.4	MAPEG family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342385

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356438	0.998	Prostaglandin G/H synthase 2
2	9606.ENSP00000354612	0.977	Prostaglandin G/H synthase 1
3	9606.ENSP00000345341	0.975	Prostaglandin E synthase 2
4	9606.ENSP00000482075	0.972	Prostaglandin E synthase 3
5	9606.ENSP00000244043	0.969	Prostacyclin synthase
6	9606.ENSP00000360687	0.962	Prostaglandin-H2 D-isomerase
7	9606.ENSP00000295256	0.950	Hematopoietic prostaglandin D synthase
8	9606.ENSP00000290349	0.943	Carbonyl reductase [NADPH] 1
9	9606.ENSP00000290354	0.900	Carbonyl reductase [NADPH] 3
10	9606.ENSP00000302846	0.823	Prostaglandin E2 receptor EP4 subtype
11	9606.ENSP00000349003	0.765	Prostaglandin E2 receptor EP3 subtype
12	9606.ENSP00000356864	0.763	Microsomal glutathione S-transferase 3
13	9606.ENSP00000292513	0.757	Prostaglandin E2 receptor EP1 subtype
14	9606.ENSP00000482639	0.739	Microsomal glutathione S-transferase 2
15	9606.ENSP00000296522	0.735	15-hydroxyprostaglandin dehydrogenase [NAD(+)]
16	9606.ENSP00000245457	0.716	Prostaglandin E2 receptor EP2 subtype
17	9606.ENSP00000369927	0.707	Aldo-keto reductase family 1 member C3
18	9606.ENSP00000389414	0.700	Thromboxane-A synthase
19	9606.ENSP00000363512	0.686	Arachidonate 5-lipoxygenase
20	9606.ENSP00000263341	0.668	Interleukin-1 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016860	1.000	intramolecular oxidoreductase activity
GO:0043295	1.000	glutathione binding
GO:0005515	0.998	protein binding
GO:0004364	0.998	glutathione transferase activity
GO:0004602	0.998	glutathione peroxidase activity
GO:0050220	0.989	prostaglandin-E synthase activity
GO:0042802	0.630	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.995	lipid metabolic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0006693	0.987	prostaglandin metabolic process
GO:0006636	0.986	unsaturated fatty acid biosynthetic process
GO:0046457	0.984	prostanoid biosynthetic process
GO:0001516	0.943	prostaglandin biosynthetic process
GO:0050896	0.628	response to stimulus
GO:0051716	0.428	cellular response to stimulus
GO:0065007	0.329	biological regulation
GO:0050789	0.311	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0031090	0.982	organelle membrane
GO:0005783	0.971	endoplasmic reticulum
GO:0031984	0.939	organelle subcompartment
GO:0042175	0.881	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.853	endoplasmic reticulum membrane
GO:0005634	0.687	nucleus
GO:0070013	0.522	intracellular organelle lumen
GO:0031981	0.367	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.3.-.-	1.000	Intramolecular oxidoreductases.
EC:2.5.1.18	0.998	glutathione transferase.
RHEA:16833	0.998	2 glutathione + H2O2 = glutathione disulfide + 2 H2O
EC:1.11.1.9	0.998	glutathione peroxidase.
RHEA:12893	0.989	prostaglandin H2 = prostaglandin E2
EC:5.3.99.3	0.989	prostaglandin-E synthase.

[back to server]