StarFunc result for job id O14713

User Input

>input (200 residues)
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTC
AEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14713	1.000	1.000	1.049E-33	200	1.000	1.000	O14713.pdb.gz	ITBP1_HUMAN Integrin beta-1-binding protein 1 OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
2	AFDB:Q8NEU8	0.498	0.171	9.519E-7	664	0.150	0.045	Q8NEU8.pdb.gz	DP13B_HUMAN DCC-interacting protein 13-beta OS=Homo sapiens OX=9606 GN=APPL2 PE=1 SV=3
3	AFDB:G5ED33	0.518	0.132	1.127E-6	917	0.145	0.032	G5ED33.pdb.gz	G5ED33_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant A OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
4	AFDB:G5EFE0	0.497	0.154	1.127E-6	740	0.150	0.041	G5EFE0.pdb.gz	G5EFE0_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant B OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
5	AFDB:Q9UKG1	0.530	0.167	1.261E-6	709	0.160	0.045	Q9UKG1.pdb.gz	DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1
6	AFDB:Q8K2Y9	0.554	0.257	1.579E-6	453	0.170	0.075	Q8K2Y9.pdb.gz	CCM2_MOUSE Cerebral cavernous malformations protein 2 homolog OS=Mus musculus OX=10090 GN=Ccm2 PE=1 SV=1
7	AFDB:Q6DRP4	0.544	0.251	1.869E-6	455	0.175	0.077	Q6DRP4.pdb.gz	CCM2_DANRE Cerebral cavernous malformations protein 2 homolog OS=Danio rerio OX=7955 GN=ccm2 PE=1 SV=1
8	AFDB:Q9BKZ9	0.503	0.172	1.977E-6	665	0.145	0.044	Q9BKZ9.pdb.gz	FEH1_CAEEL Protein Fe65 homolog OS=Caenorhabditis elegans OX=6239 GN=feh-1 PE=1 SV=2
9	AFDB:P59672	0.497	0.103	2.091E-6	1150	0.140	0.024	P59672.pdb.gz	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
10	AFDB:O35827	0.494	0.215	2.212E-6	504	0.145	0.058	O35827.pdb.gz	APBB3_RAT Amyloid-beta A4 precursor protein-binding family B member 3 OS=Rattus norvegicus OX=10116 GN=Apbb3 PE=1 SV=1
11	PDB:7k041	0.313	0.146	8.192E-3	487	0.075	0.031	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
12	PDB:7o4i1	0.317	0.139	1.148E-2	522	0.070	0.027	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:6r9tA	0.344	0.037	1.800E-2	2185	0.080	0.007	6r9tA.pdb.gz
14	PDB:3cm1A	0.277	0.365	1.904E-2	137	0.065	0.095	3cm1A.pdb.gz
15	PDB:4rm8A	0.358	0.202	2.384E-2	368	0.070	0.038	4rm8A.pdb.gz
16	PDB:4mk0A	0.387	0.135	2.522E-2	631	0.065	0.021	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	PDB:5oqj1	0.317	0.144	2.522E-2	491	0.085	0.035	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:3elzB	0.182	0.245	2.822E-2	135	0.060	0.089	3elzB.pdb.gz	The X-Ray structure of zebrafish (Danio rerio) ileal bile acid-binding protein reveals the presence of binding sites on the surface of the protein molecule.
19	PDB:7c3mA	0.327	0.131	3.158E-2	577	0.045	0.016	7c3mA.pdb.gz
20	PDB:2kr0A	0.301	0.170	5.862E-2	407	0.095	0.047	2kr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14713	6.96e-147	408	200	1.000	1.000	ITBP1_HUMAN Integrin beta-1-binding protein 1 OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
2	A8MPU2	7.16e-129	362	184	0.885	0.962	A8MPU2_HUMAN Integrin beta 1 binding protein 1, isoform CRA_g OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
3	O35671	2.22e-120	341	200	0.940	0.940	ITBP1_MOUSE Integrin beta-1-binding protein 1 OS=Mus musculus OX=10090 GN=Itgb1bp1 PE=1 SV=1
4	C9JBU8	1.29e-95	276	136	0.680	1.000	C9JBU8_HUMAN Integrin subunit beta 1 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
5	C9J5T5	7.96e-78	230	114	0.570	1.000	C9J5T5_HUMAN Integrin subunit beta 1 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
6	C9JZ07	1.15e-61	188	96	0.480	1.000	C9JZ07_HUMAN Integrin subunit beta 1 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
7	C9J0J6	2.93e-53	167	86	0.430	1.000	C9J0J6_HUMAN Integrin subunit beta 1 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
8	C9J6Y2	2.28e-51	162	84	0.420	1.000	C9J6Y2_HUMAN Integrin subunit beta 1 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
9	C9IZZ8	1.03e-36	124	65	0.325	1.000	C9IZZ8_HUMAN Integrin subunit beta 1 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=ITGB1BP1 PE=1 SV=1
10	Q6J4I0	3.9	30.0	205	0.060	0.059	PPR1B_RAT Protein phosphatase 1 regulatory subunit 1B OS=Rattus norvegicus OX=10116 GN=Ppp1r1b PE=1 SV=1
11	F1LN46	4.0	30.8	801	0.090	0.022	CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus OX=10116 GN=Cpt1c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13200 DUF4015	4.5e+02	11.3	Putative glycosyl hydrolase domain
2	PF01763 Herpes_UL6	4.3e+02	10.8	Herpesvirus UL6 like
3	PF10480 ICAP-1_inte_bdg	5.7e-129	439.6	Beta-1 integrin binding protein
4	PF00640 PID	0.71	21.3	Phosphotyrosine interaction domain (PTB/PID)
5	PF03795 YCII	5.8e+02	12.3	YCII-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378015	0.999	Krev interaction trapped protein 1
2	9606.ENSP00000379350	0.999	Integrin beta-1
3	9606.ENSP00000370503	0.971	Cerebral cavernous malformations 2 protein
4	9606.ENSP00000376889	0.955	Nucleoside diphosphate kinase
5	9606.ENSP00000376506	0.762	Programmed cell death protein 10
6	9606.ENSP00000355319	0.716	CLOCK-interacting pacemaker
7	9606.ENSP00000407130	0.678	Zinc finger protein 410
8	9606.ENSP00000356602	0.677	Vacuolar protein sorting-associated protein VTA1 homolog
9	9606.ENSP00000258042	0.668	Neuromedin-B receptor
10	9606.ENSP00000281419	0.668	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
11	9606.ENSP00000356575	0.666	Transcription factor HIVEP2
12	9606.ENSP00000357005	0.654	Junctional adhesion molecule A
13	9606.ENSP00000263918	0.648	Striatin
14	9606.ENSP00000245304	0.643	Ras-related protein Rap-2a
15	9606.ENSP00000358723	0.642	Ras-related protein Rap-1A
16	9606.ENSP00000376886	0.611	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
17	9606.ENSP00000337060	0.607	Nucleoside diphosphate kinase A
18	9606.ENSP00000377699	0.605	Adhesion G-protein coupled receptor G4
19	9606.ENSP00000313921	0.588	Mitochondrial peptide methionine sulfoxide reductase
20	9606.ENSP00000338348	0.582	Ubiquitin-conjugating enzyme E2 G2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0044877	0.997	protein-containing complex binding
GO:0050839	0.997	cell adhesion molecule binding
GO:0005092	0.995	GDP-dissociation inhibitor activity
GO:0005178	0.994	integrin binding
GO:0019899	0.490	enzyme binding
GO:0019901	0.483	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.973	response to stimulus
GO:0048519	0.968	negative regulation of biological process
GO:0048518	0.964	positive regulation of biological process
GO:0007165	0.940	signal transduction
GO:0048522	0.931	positive regulation of cellular process
GO:0051128	0.924	regulation of cellular component organization
GO:0048523	0.913	negative regulation of cellular process
GO:0016043	0.910	cellular component organization
GO:0023051	0.899	regulation of signaling
GO:0010646	0.899	regulation of cell communication
GO:0022607	0.897	cellular component assembly
GO:0009966	0.891	regulation of signal transduction
GO:0051641	0.883	cellular localization
GO:0019222	0.879	regulation of metabolic process
GO:0030155	0.869	regulation of cell adhesion
GO:1902903	0.868	regulation of supramolecular fiber organization
GO:0040012	0.866	regulation of locomotion
GO:0110053	0.864	regulation of actin filament organization
GO:0030334	0.863	regulation of cell migration
GO:0048856	0.846	anatomical structure development
GO:0032501	0.836	multicellular organismal process
GO:0033157	0.833	regulation of intracellular protein transport
GO:0030336	0.832	negative regulation of cell migration
GO:0010810	0.829	regulation of cell-substrate adhesion
GO:0060255	0.828	regulation of macromolecule metabolic process
GO:0033036	0.827	macromolecule localization
GO:0016477	0.822	cell migration
GO:0150116	0.822	regulation of cell-substrate junction organization
GO:0044087	0.817	regulation of cellular component biogenesis
GO:1900024	0.815	regulation of substrate adhesion-dependent cell spreading
GO:0051668	0.812	localization within membrane
GO:1903829	0.811	positive regulation of protein localization
GO:0008104	0.810	protein localization
GO:0045785	0.808	positive regulation of cell adhesion
GO:0031323	0.787	regulation of cellular metabolic process
GO:0072657	0.777	protein localization to membrane
GO:1903533	0.774	regulation of protein targeting
GO:0051171	0.772	regulation of nitrogen compound metabolic process
GO:0001952	0.770	regulation of cell-matrix adhesion
GO:1901888	0.769	regulation of cell junction assembly
GO:0010811	0.762	positive regulation of cell-substrate adhesion
GO:0080090	0.761	regulation of primary metabolic process
GO:0051893	0.760	regulation of focal adhesion assembly
GO:1905475	0.755	regulation of protein localization to membrane
GO:0010812	0.753	negative regulation of cell-substrate adhesion
GO:0051129	0.747	negative regulation of cellular component organization
GO:0051239	0.724	regulation of multicellular organismal process
GO:0007155	0.710	cell adhesion
GO:1901889	0.707	negative regulation of cell junction assembly
GO:0010604	0.698	positive regulation of macromolecule metabolic process
GO:0007166	0.657	cell surface receptor signaling pathway
GO:1902531	0.656	regulation of intracellular signal transduction
GO:0051246	0.627	regulation of protein metabolic process
GO:0001954	0.626	positive regulation of cell-matrix adhesion
GO:0048584	0.625	positive regulation of response to stimulus
GO:0065009	0.623	regulation of molecular function
GO:0051050	0.601	positive regulation of transport
GO:0009653	0.581	anatomical structure morphogenesis
GO:0051173	0.579	positive regulation of nitrogen compound metabolic process
GO:0065008	0.578	regulation of biological quality
GO:0010468	0.569	regulation of gene expression
GO:0030335	0.473	positive regulation of cell migration
GO:1902533	0.401	positive regulation of intracellular signal transduction
GO:0051247	0.384	positive regulation of protein metabolic process
GO:0007275	0.355	multicellular organism development
GO:0110020	0.353	regulation of actomyosin structure organization
GO:0035556	0.340	intracellular signal transduction
GO:0031325	0.334	positive regulation of cellular metabolic process
GO:0050790	0.333	regulation of catalytic activity
GO:0009892	0.333	negative regulation of metabolic process
GO:0031399	0.331	regulation of protein modification process
GO:0019220	0.328	regulation of phosphate metabolic process
GO:0010605	0.324	negative regulation of macromolecule metabolic process
GO:0051130	0.301	positive regulation of cellular component organization
GO:0044093	0.300	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0071944	0.996	cell periphery
GO:0016020	0.996	membrane
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005886	0.993	plasma membrane
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005856	0.962	cytoskeleton
GO:0031252	0.922	cell leading edge
GO:0120025	0.895	plasma membrane bounded cell projection
GO:0030027	0.800	lamellipodium
GO:0001726	0.762	ruffle
GO:0015630	0.414	microtubule cytoskeleton
GO:0005815	0.348	microtubule organizing center
GO:0012505	0.347	endomembrane system
GO:0005813	0.330	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]