StarFunc result for job id O14727

User Input

>input (1248 residues)
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3sfzA	0.898	0.988	0.000	1133	0.796	0.876	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
2	PDB:5juyB	0.551	0.557	0.000	1234	0.984	0.995	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
3	AFDB:O14727	1.000	1.000	0.000	1248	1.000	1.000	O14727.pdb.gz	APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens OX=9606 GN=APAF1 PE=1 SV=2
4	AFDB:O88879	0.570	0.570	0.000	1249	0.873	0.873	O88879.pdb.gz	APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus OX=10090 GN=Apaf1 PE=1 SV=3
5	AFDB:Q99973	0.483	0.268	4.185E-43	2627	0.192	0.091	Q99973.pdb.gz	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
6	AFDB:O08653	0.544	0.295	1.075E-41	2629	0.177	0.084	O08653.pdb.gz	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
7	AFDB:P97499	0.301	0.161	1.363E-41	2629	0.186	0.088	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
8	AFDB:O62471	0.463	0.377	2.107E-41	1592	0.156	0.122	O62471.pdb.gz	QUI1_CAEEL Protein qui-1 OS=Caenorhabditis elegans OX=6239 GN=qui-1 PE=1 SV=2
9	AFDB:Q149M9	0.450	0.378	1.716E-34	1564	0.151	0.121	Q149M9.pdb.gz	NWD1_HUMAN NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3
10	AFDB:Q585R2	0.312	0.270	1.209E-29	1537	0.123	0.100	Q585R2.pdb.gz	Q585R2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.130 PE=4 SV=1
11	AFDB:Q12788	0.233	0.320	1.407E-28	808	0.094	0.145	Q12788.pdb.gz	TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2
12	AFDB:Q5U3Q5	0.235	0.296	2.548E-28	897	0.100	0.139	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
13	PDB:7mq8LR	0.246	0.348	6.025E-28	773	0.091	0.146	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaLQ	0.244	0.342	5.945E-26	830	0.087	0.130	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5julA	0.475	0.480	3.240E-24	1233	0.143	0.145	5julA.pdb.gz	A Near-Atomic Structure of the Dark Apoptosome Provides Insight into Assembly and Activation.
16	PDB:7mq8LT	0.205	0.280	6.873E-24	869	0.084	0.121	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8LO	0.207	0.280	7.439E-24	848	0.077	0.113	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7rroe	0.247	0.444	3.770E-23	610	0.081	0.166	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:7mqaLO	0.210	0.305	5.384E-23	819	0.076	0.116	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6lqsB1	0.204	0.310	2.423E-22	806	0.084	0.130	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14727	0.0	2593	1248	1.000	1.000	APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens OX=9606 GN=APAF1 PE=1 SV=2
2	O88879	0.0	2295	1249	0.874	0.873	APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus OX=10090 GN=Apaf1 PE=1 SV=3
3	Q9EPV5	0.0	2298	1249	0.874	0.873	APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus OX=10116 GN=Apaf1 PE=1 SV=1
4	Q9M2Z2	5.43e-34	135	317	0.075	0.297	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
5	O62471	1.21e-28	127	1592	0.119	0.093	QUI1_CAEEL Protein qui-1 OS=Caenorhabditis elegans OX=6239 GN=qui-1 PE=1 SV=2
6	Q9V3J8	5.16e-28	119	361	0.071	0.247	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
7	P61964	1.64e-27	117	334	0.070	0.260	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
8	P61965	1.64e-27	117	334	0.070	0.260	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
9	Q498M4	1.64e-27	117	334	0.070	0.260	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
10	Q7ZTX2	2.61e-27	116	334	0.070	0.260	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
11	Q3Y8L7	8.91e-27	117	446	0.065	0.182	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
12	Q54KL5	1.39e-26	114	335	0.065	0.242	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
13	Q8N136	2.47e-25	112	415	0.063	0.190	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
14	D3Z7A5	2.09e-24	109	415	0.065	0.195	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
15	Q4V8C4	2.69e-24	107	328	0.067	0.253	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
16	Q57W14	6.77e-24	108	419	0.060	0.179	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
17	Q9XI22	1.42e-23	105	333	0.068	0.255	Q9XI22_ARATH F9L1.42 protein OS=Arabidopsis thaliana OX=3702 GN=XIW1 PE=1 SV=1
18	Q57X86	1.91e-23	109	698	0.058	0.105	Q57X86_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.470 PE=4 SV=1
19	P25382	2.07e-23	108	515	0.069	0.167	NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSA4 PE=1 SV=3
20	O08653	3.66e-23	110	2629	0.143	0.068	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.088	24.7	AAA ATPase domain
2	PF13401 AAA_22	1.2e+02	14.3	AAA domain
3	PF12894 ANAPC4_WD40	1.4e-26	103.9	Anaphase-promoting complex subunit 4 WD40 domain
4	PF17908 APAF1_C	2.8e-54	194.2	APAF-1 helical domain
5	PF10312 Cactin_mid	2.5e+02	12.8	Conserved mid region of cactin
6	PF00619 CARD	6.6e-16	69.4	Caspase recruitment domain
7	PF16739 CARD_2	0.00028	32.1	Caspase recruitment domain
8	PF08662 eIF2A	7.5e-09	47.3	Eukaryotic translation initiation factor eIF2A
9	PF16529 Ge1_WD40	1.8e-05	35.6	WD40 region of Ge1, enhancer of mRNA-decapping protein
10	PF05729 NACHT	1.2e+02	14.0	NACHT domain
11	PF00931 NB-ARC	4e-65	231.1	NB-ARC domain
12	PF15492 Nbas_N	11	16.9	Neuroblastoma-amplified sequence, N terminal
13	PF20426 NBCH_WD40	4.4e-14	63.7	Neurobeachin beta propeller domain
14	PF07676 PD40	3.4e+02	12.6	WD40-like Beta Propeller Repeat
15	PF10395 Utp8	0.2	21.7	Utp8 family
16	PF00400 WD40	3.1e-59	206.7	WD domain, G-beta repeat
17	PF17005 WD40_like	7.8e-07	40.3	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000448165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.999	Bcl-2-like protein 1
2	9606.ENSP00000307786	0.999	Cytochrome c
3	9606.ENSP00000330237	0.999	Caspase-9
4	9606.ENSP00000302961	0.996	Heat shock protein family A member 4
5	9606.ENSP00000311032	0.996	Caspase-3
6	9606.ENSP00000360242	0.996	E3 ubiquitin-protein ligase XIAP
7	9606.ENSP00000398495	0.995	Diablo homolog, mitochondrial
8	9606.ENSP00000335153	0.992	Heat shock protein HSP 90-alpha
9	9606.ENSP00000293288	0.987	Apoptosis regulator BAX
10	9606.ENSP00000379133	0.987	Methylthioribulose-1-phosphate dehydratase
11	9606.ENSP00000358327	0.984	Caspase-7
12	9606.ENSP00000265164	0.980	Caspase-6
13	9606.ENSP00000363591	0.980	Bcl-2 homologous antagonist/killer
14	9606.ENSP00000269305	0.974	Cellular tumor antigen p53
15	9606.ENSP00000381185	0.973	Apoptosis regulator Bcl-2
16	9606.ENSP00000477613	0.970	Baculoviral IAP repeat-containing protein 2
17	9606.ENSP00000451828	0.965	RAC-alpha serine/threonine-protein kinase
18	9606.ENSP00000263464	0.963	Baculoviral IAP repeat-containing protein 3
19	9606.ENSP00000375767	0.963	Caspase recruitment domain-containing protein 8
20	9606.ENSP00000216115	0.950	Bcl-2-interacting killer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0008656	0.999	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0097159	0.982	organic cyclic compound binding
GO:1901363	0.975	heterocyclic compound binding
GO:0031072	0.794	heat shock protein binding
GO:0036094	0.609	small molecule binding
GO:1901265	0.585	nucleoside phosphate binding
GO:0000166	0.572	nucleotide binding
GO:0019899	0.366	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0019222	0.995	regulation of metabolic process
GO:0080090	0.994	regulation of primary metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0008219	0.991	cell death
GO:0048522	0.986	positive regulation of cellular process
GO:0009893	0.985	positive regulation of metabolic process
GO:0051716	0.983	cellular response to stimulus
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0006915	0.972	apoptotic process
GO:0051246	0.967	regulation of protein metabolic process
GO:0051173	0.967	positive regulation of nitrogen compound metabolic process
GO:0065009	0.965	regulation of molecular function
GO:0007154	0.965	cell communication
GO:0008152	0.957	metabolic process
GO:0043085	0.955	positive regulation of catalytic activity
GO:2000116	0.955	regulation of cysteine-type endopeptidase activity
GO:0071704	0.954	organic substance metabolic process
GO:0023052	0.952	signaling
GO:0043065	0.950	positive regulation of apoptotic process
GO:0006919	0.946	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0032501	0.945	multicellular organismal process
GO:0044238	0.943	primary metabolic process
GO:0032502	0.942	developmental process
GO:0097190	0.937	apoptotic signaling pathway
GO:0048856	0.910	anatomical structure development
GO:0006807	0.883	nitrogen compound metabolic process
GO:0043170	0.835	macromolecule metabolic process
GO:0006950	0.829	response to stress
GO:0097193	0.817	intrinsic apoptotic signaling pathway
GO:0007275	0.798	multicellular organism development
GO:0031323	0.784	regulation of cellular metabolic process
GO:0007399	0.780	nervous system development
GO:0006508	0.754	proteolysis
GO:0048583	0.632	regulation of response to stimulus
GO:0010467	0.592	gene expression
GO:0051604	0.564	protein maturation
GO:0016485	0.549	protein processing
GO:0042221	0.542	response to chemical
GO:0023051	0.541	regulation of signaling
GO:0010646	0.524	regulation of cell communication
GO:0009966	0.510	regulation of signal transduction
GO:0048584	0.493	positive regulation of response to stimulus
GO:0033554	0.492	cellular response to stress
GO:0070887	0.478	cellular response to chemical stimulus
GO:0019219	0.444	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.440	cellular component organization or biogenesis
GO:0048519	0.430	negative regulation of biological process
GO:0010033	0.426	response to organic substance
GO:0048513	0.399	animal organ development
GO:0044237	0.399	cellular metabolic process
GO:0016043	0.396	cellular component organization
GO:0048523	0.389	negative regulation of cellular process
GO:0010468	0.365	regulation of gene expression
GO:0007420	0.356	brain development
GO:0009719	0.347	response to endogenous stimulus
GO:0009967	0.330	positive regulation of signal transduction
GO:0031325	0.313	positive regulation of cellular metabolic process
GO:0009605	0.312	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0032991	0.965	protein-containing complex
GO:0070013	0.954	intracellular organelle lumen
GO:0005634	0.940	nucleus
GO:0012505	0.309	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]