StarFunc result for job id O14730

User Input

>input (519 residues)
MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVA
VAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVH
PYEDSDSSEDEVDWQDTRDDPYRPAKPVPTPKKGFIGKGKDITTKHDEVVCGRKNTARME
NFAPEFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRLL
MYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFK
NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMS
FIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVW
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEAD
FLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14730	1.000	1.000	9.977E-94	519	1.000	1.000	O14730.pdb.gz	RIOK3_HUMAN Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 PE=1 SV=2
2	AFDB:Q9BRS2	0.442	0.404	7.190E-31	568	0.281	0.257	Q9BRS2.pdb.gz	RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2
3	AFDB:Q9VTL5	0.460	0.410	1.488E-29	585	0.276	0.244	Q9VTL5.pdb.gz	Q9VTL5_DROME Serine/threonine-protein kinase RIO1 OS=Drosophila melanogaster OX=7227 GN=RIOK1 PE=2 SV=1
4	AFDB:O44959	0.466	0.477	1.039E-28	506	0.295	0.302	O44959.pdb.gz	RIOK1_CAEEL Serine/threonine-protein kinase RIO1 OS=Caenorhabditis elegans OX=6239 GN=riok-1 PE=2 SV=5
5	AFDB:O42650	0.440	0.459	5.148E-28	497	0.266	0.278	O42650.pdb.gz	RIO1_SCHPO Serine/threonine-protein kinase rio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio1 PE=3 SV=2
6	AFDB:G5EAT2	0.451	0.420	2.409E-27	558	0.262	0.244	G5EAT2.pdb.gz	G5EAT2_EMENI Serine/threonine-protein kinase RIO1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06363 PE=3 SV=1
7	PDB:6zxfz	0.459	0.629	4.882E-27	373	0.254	0.354	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
8	AFDB:Q12196	0.438	0.468	1.782E-26	484	0.235	0.252	Q12196.pdb.gz	RIO1_YEAST Serine/threonine-protein kinase RIO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO1 PE=1 SV=1
9	PDB:6zxdz	0.381	0.669	1.210E-22	292	0.231	0.411	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
10	PDB:6g18v	0.311	0.484	2.131E-11	325	0.096	0.154	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
11	PDB:6fail	0.321	0.556	3.260E-9	286	0.075	0.136	6fail.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
12	AFDB:P18161	0.245	0.119	9.861E-8	1155	0.118	0.053	P18161.pdb.gz	SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum OX=44689 GN=splB PE=2 SV=2
13	AFDB:Q9VJ90	0.237	0.190	2.195E-7	665	0.118	0.092	Q9VJ90.pdb.gz	Q9VJ90_DROME FI19424p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5790 PE=2 SV=1
14	PDB:6wqxC	0.263	0.539	2.372E-7	231	0.087	0.195	6wqxC.pdb.gz	Crystal structure of the human PRPK-TPRKB complex.
15	AFDB:Q54I36	0.251	0.106	1.367E-6	1338	0.106	0.041	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
16	PDB:4ww9A	0.263	0.499	1.477E-6	238	0.085	0.185	4ww9A.pdb.gz	Crystal structures of the Gon7/Pcc1 and Bud32/Cgi121 complexes provide a model for the complete yeast KEOPS complex.
17	PDB:6qx9K	0.252	0.380	1.032E-5	322	0.077	0.124	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:2yaaA	0.256	0.415	1.225E-5	300	0.085	0.147	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
19	PDB:5oniA	0.225	0.338	1.935E-5	334	0.067	0.105	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
20	PDB:7cgaA	0.276	0.395	2.049E-5	347	0.069	0.104	7cgaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14730	0.0	1086	519	1.000	1.000	RIOK3_HUMAN Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 PE=1 SV=2
2	Q9BRS2	3.34e-86	278	568	0.260	0.238	RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2
3	Q9VTL5	7.64e-81	265	585	0.235	0.209	Q9VTL5_DROME Serine/threonine-protein kinase RIO1 OS=Drosophila melanogaster OX=7227 GN=RIOK1 PE=2 SV=1
4	O44959	1.11e-79	259	506	0.241	0.247	RIOK1_CAEEL Serine/threonine-protein kinase RIO1 OS=Caenorhabditis elegans OX=6239 GN=riok-1 PE=2 SV=5
5	O42650	1.32e-73	243	497	0.229	0.239	RIO1_SCHPO Serine/threonine-protein kinase rio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio1 PE=3 SV=2
6	G5EAT2	1.60e-71	239	558	0.233	0.217	G5EAT2_EMENI Serine/threonine-protein kinase RIO1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06363 PE=3 SV=1
7	Q12196	7.28e-60	207	484	0.222	0.238	RIO1_YEAST Serine/threonine-protein kinase RIO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO1 PE=1 SV=1
8	Q9P7W5	6.79e-07	53.5	344	0.091	0.137	RIO2_SCHPO Serine/threonine-protein kinase rio2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio2 PE=3 SV=2
9	Q9BVS4	3.10e-05	48.9	552	0.098	0.092	RIOK2_HUMAN Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2
10	Q95Q34	3.34e-05	48.9	529	0.089	0.087	RIOK2_CAEEL Serine/threonine-protein kinase RIO2 OS=Caenorhabditis elegans OX=6239 GN=riok-2 PE=2 SV=2
11	Q9VBU2	2.06e-04	46.2	538	0.092	0.089	Q9VBU2_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=RIOK2 PE=3 SV=1
12	Q9UYB9	0.001	43.1	220	0.077	0.182	BUD32_PYRAB KEOPS complex subunit Bud32 OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=bud32 PE=1 SV=1
13	Q9NQW7	0.34	36.2	623	0.058	0.048	XPP1_HUMAN Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1 PE=1 SV=3
14	Q38BS3	0.39	35.8	373	0.046	0.064	Q38BS3_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4250 PE=4 SV=1
15	Q5T6H7	0.43	35.8	552	0.058	0.054	Q5T6H7_HUMAN X-prolyl aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1 PE=1 SV=1
16	F4KC57	1.5	33.5	243	0.035	0.074	F4KC57_ARATH SNF7 family protein OS=Arabidopsis thaliana OX=3702 GN=VPS201 PE=1 SV=1
17	Q5B953	5.4	32.3	828	0.044	0.028	Q5B953_EMENI Checkpoint protein kinase, putative (AFU_orthologue AFUA_3G08100) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02927 PE=4 SV=1
18	Q9S7U9	6.0	32.0	363	0.046	0.066	M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MKK2 PE=1 SV=2
19	Q5B3E4	7.4	32.0	780	0.031	0.021	Q5B3E4_EMENI non-specific serine/threonine protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04936 PE=3 SV=1
20	Q54KF1	8.0	32.0	1158	0.060	0.027	FORC_DICDI Formin-C OS=Dictyostelium discoideum OX=44689 GN=forC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.8	17.8	ABC1 atypical kinase-like domain
2	PF01636 APH	1.4e+02	13.7	Phosphotransferase enzyme family
3	PF06293 Kdo	2	19.3	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	24	15.8	Protein kinase domain
5	PF01163 RIO1	7.3e-72	252.5	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341874

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283109	0.992	Serine/threonine-protein kinase RIO2
2	9606.ENSP00000263657	0.980	RNA-binding protein PNO1
3	9606.ENSP00000268802	0.972	RNA-binding protein NOB1
4	9606.ENSP00000356548	0.972	Protein LTV1 homolog
5	9606.ENSP00000230340	0.967	Bystin
6	9606.ENSP00000301364	0.948	Pre-rRNA-processing protein TSR1 homolog
7	9606.ENSP00000385958	0.921	Ribosomal protein S14
8	9606.ENSP00000251453	0.920	Ribosomal protein S16
9	9606.ENSP00000369162	0.919	Serine/threonine-protein kinase RIO1
10	9606.ENSP00000278572	0.917	40S ribosomal protein S3
11	9606.ENSP00000379339	0.916	Ribosomal protein S29
12	9606.ENSP00000339095	0.912	40S ribosomal protein S7
13	9606.ENSP00000467466	0.912	Ribosomal protein S15
14	9606.ENSP00000472985	0.912	Ribosomal protein S5
15	9606.ENSP00000346050	0.909	40S ribosomal protein S3a
16	9606.ENSP00000362744	0.908	Ribosomal protein S4, X-linked
17	9606.ENSP00000393241	0.908	40S ribosomal protein S18
18	9606.ENSP00000401191	0.908	Probable 18S rRNA (guanine-N(7))-methyltransferase
19	9606.ENSP00000324464	0.907	Casein kinase I isoform delta
20	9606.ENSP00000380044	0.907	Casein kinase I isoform epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0089720	1.000	caspase binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0034470	0.988	ncRNA processing
GO:0042254	0.986	ribosome biogenesis
GO:0065007	0.983	biological regulation
GO:0016072	0.980	rRNA metabolic process
GO:0009893	0.974	positive regulation of metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0048519	0.969	negative regulation of biological process
GO:0010468	0.964	regulation of gene expression
GO:0050794	0.962	regulation of cellular process
GO:0006364	0.953	rRNA processing
GO:0010604	0.939	positive regulation of macromolecule metabolic process
GO:0042274	0.648	ribosomal small subunit biogenesis
GO:0050896	0.508	response to stimulus
GO:0048584	0.498	positive regulation of response to stimulus
GO:1902531	0.479	regulation of intracellular signal transduction
GO:0048523	0.473	negative regulation of cellular process
GO:0010628	0.451	positive regulation of gene expression
GO:0071359	0.403	cellular response to dsRNA
GO:0051240	0.401	positive regulation of multicellular organismal process
GO:0009968	0.395	negative regulation of signal transduction
GO:0048522	0.392	positive regulation of cellular process
GO:1901564	0.385	organonitrogen compound metabolic process
GO:0002684	0.380	positive regulation of immune system process
GO:0032103	0.379	positive regulation of response to external stimulus
GO:0030490	0.379	maturation of SSU-rRNA
GO:0001819	0.378	positive regulation of cytokine production
GO:0002683	0.377	negative regulation of immune system process
GO:0032479	0.377	regulation of type I interferon production
GO:0002832	0.376	negative regulation of response to biotic stimulus
GO:0031349	0.376	positive regulation of defense response
GO:0032102	0.375	negative regulation of response to external stimulus
GO:0031348	0.375	negative regulation of defense response
GO:0039531	0.375	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:1902532	0.372	negative regulation of intracellular signal transduction
GO:0050687	0.366	negative regulation of defense response to virus
GO:0043207	0.345	response to external biotic stimulus
GO:0043254	0.341	regulation of protein-containing complex assembly
GO:0098586	0.340	cellular response to virus
GO:0051129	0.332	negative regulation of cellular component organization
GO:0050778	0.328	positive regulation of immune response
GO:0007049	0.326	cell cycle
GO:0032481	0.326	positive regulation of type I interferon production
GO:0032648	0.325	regulation of interferon-beta production
GO:0045089	0.323	positive regulation of innate immune response
GO:0019538	0.322	protein metabolic process
GO:0032728	0.322	positive regulation of interferon-beta production
GO:0031333	0.304	negative regulation of protein-containing complex assembly
GO:0007059	0.300	chromosome segregation
GO:0043122	0.300	regulation of I-kappaB kinase/NF-kappaB signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:1990904	0.996	ribonucleoprotein complex
GO:0030688	0.984	preribosome, small subunit precursor
GO:0070013	0.967	intracellular organelle lumen
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0031981	0.916	nuclear lumen
GO:0043232	0.906	intracellular non-membrane-bounded organelle
GO:0005654	0.393	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]