StarFunc result for job id O14732

User Input

>input (288 residues)
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
GFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDP
ATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIR
EAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91UZ5	0.954	0.947	1.505E-55	290	0.889	0.883	Q91UZ5.pdb.gz	IMPA2_MOUSE Inositol monophosphatase 2 OS=Mus musculus OX=10090 GN=Impa2 PE=1 SV=1
2	PDB:2cziA	0.860	0.955	3.567E-44	259	0.896	0.996	2cziA.pdb.gz	Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
3	AFDB:P20456	0.952	0.989	2.369E-43	277	0.514	0.534	P20456.pdb.gz	IMPA1_BOVIN Inositol monophosphatase 1 OS=Bos taurus OX=9913 GN=IMPA1 PE=1 SV=1
4	AFDB:O55023	0.951	0.989	5.698E-43	277	0.510	0.531	O55023.pdb.gz	IMPA1_MOUSE Inositol monophosphatase 1 OS=Mus musculus OX=10090 GN=Impa1 PE=1 SV=1
5	AFDB:P29218	0.951	0.988	7.634E-43	277	0.510	0.531	P29218.pdb.gz	IMPA1_HUMAN Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1
6	PDB:4as5A	0.935	0.983	3.353E-41	274	0.500	0.526	4as5A.pdb.gz	Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
7	PDB:6giuA	0.943	0.988	3.555E-41	275	0.507	0.531	6giuA.pdb.gz	Co-crystallization of human inositol monophosphatase with the lithium mimetic L-690,330.
8	PDB:2bjiA	0.935	0.982	3.097E-40	274	0.507	0.533	2bjiA.pdb.gz	High-resolution structure of myo-inositol monophosphatase, the putative target of lithium therapy.
9	PDB:7vceB	0.845	0.976	1.649E-35	249	0.465	0.538	7vceB.pdb.gz
10	AFDB:Q9M8S8	0.880	0.935	3.968E-34	271	0.410	0.435	Q9M8S8.pdb.gz	VTC4_ARATH Inositol-phosphate phosphatase OS=Arabidopsis thaliana OX=3702 GN=VTC4 PE=1 SV=1
11	AFDB:P54926	0.886	0.934	5.316E-34	273	0.396	0.418	P54926.pdb.gz	IMP1_SOLLC Inositol monophosphatase 1 OS=Solanum lycopersicum OX=4081 GN=IMP1 PE=1 SV=1
12	AFDB:P54928	0.882	0.946	2.042E-33	268	0.389	0.418	P54928.pdb.gz	IMP3_SOLLC Inositol monophosphatase 3 OS=Solanum lycopersicum OX=4081 GN=IMP3 PE=1 SV=1
13	AFDB:P54927	0.878	0.952	5.521E-33	265	0.392	0.426	P54927.pdb.gz	IMP2_SOLLC Inositol monophosphatase 2 OS=Solanum lycopersicum OX=4081 GN=IMP2 PE=1 SV=1
14	AFDB:Q19420	0.877	0.887	7.397E-33	285	0.382	0.386	Q19420.pdb.gz	IMPA1_CAEEL Inositol monophosphatase ttx-7 OS=Caenorhabditis elegans OX=6239 GN=ttx-7 PE=1 SV=3
15	AFDB:Q54U72	0.870	0.920	1.069E-30	272	0.306	0.324	Q54U72.pdb.gz	IMPA1_DICDI Inositol monophosphatase OS=Dictyostelium discoideum OX=44689 GN=impa1 PE=3 SV=1
16	PDB:6ib8B	0.819	0.871	6.902E-25	270	0.302	0.322	6ib8B.pdb.gz	Structural basis for the function of SuhB as a transcription factor in ribosomal RNA synthesis.
17	PDB:2q74A	0.693	0.809	4.549E-19	245	0.281	0.331	2q74A.pdb.gz
18	PDB:5zonA	0.721	0.806	4.549E-19	256	0.264	0.297	5zonA.pdb.gz	Identification and structural characterization of a histidinol phosphate phosphatase from Mycobacterium tuberculosis
19	PDB:2wefA	0.708	0.675	8.138E-16	303	0.250	0.238	2wefA.pdb.gz	Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) in Complex with AMP, Po4 and Magnesium
20	PDB:1k9yA	0.765	0.628	1.642E-15	354	0.236	0.192	1k9yA.pdb.gz	Structural enzymology of Li(+)-sensitive/Mg(2+)-dependent phosphatases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14732	0.0	591	288	1.000	1.000	IMPA2_HUMAN Inositol monophosphatase 2 OS=Homo sapiens OX=9606 GN=IMPA2 PE=1 SV=1
2	Q91UZ5	0.0	540	290	0.910	0.903	IMPA2_MOUSE Inositol monophosphatase 2 OS=Mus musculus OX=10090 GN=Impa2 PE=1 SV=1
3	P97697	1.38e-119	345	277	0.528	0.549	IMPA1_RAT Inositol monophosphatase 1 OS=Rattus norvegicus OX=10116 GN=Impa1 PE=1 SV=2
4	P20456	3.24e-119	344	277	0.514	0.534	IMPA1_BOVIN Inositol monophosphatase 1 OS=Bos taurus OX=9913 GN=IMPA1 PE=1 SV=1
5	O55023	6.84e-118	341	277	0.510	0.531	IMPA1_MOUSE Inositol monophosphatase 1 OS=Mus musculus OX=10090 GN=Impa1 PE=1 SV=1
6	P29218	1.45e-117	340	277	0.510	0.531	IMPA1_HUMAN Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1 PE=1 SV=1
7	Q19420	5.18e-70	219	285	0.375	0.379	IMPA1_CAEEL Inositol monophosphatase ttx-7 OS=Caenorhabditis elegans OX=6239 GN=ttx-7 PE=1 SV=3
8	Q9M8S8	8.09e-69	216	271	0.399	0.424	VTC4_ARATH Inositol-phosphate phosphatase OS=Arabidopsis thaliana OX=3702 GN=VTC4 PE=1 SV=1
9	P54926	3.39e-67	212	273	0.403	0.425	IMP1_SOLLC Inositol monophosphatase 1 OS=Solanum lycopersicum OX=4081 GN=IMP1 PE=1 SV=1
10	P54928	2.52e-66	209	268	0.392	0.422	IMP3_SOLLC Inositol monophosphatase 3 OS=Solanum lycopersicum OX=4081 GN=IMP3 PE=1 SV=1
11	P54927	2.53e-64	204	265	0.406	0.442	IMP2_SOLLC Inositol monophosphatase 2 OS=Solanum lycopersicum OX=4081 GN=IMP2 PE=1 SV=1
12	Q54U72	1.01e-55	182	272	0.299	0.316	IMPA1_DICDI Inositol monophosphatase OS=Dictyostelium discoideum OX=44689 GN=impa1 PE=3 SV=1
13	P0ADG4	1.01e-42	149	267	0.302	0.326	SUHB_ECOLI Nus factor SuhB OS=Escherichia coli (strain K12) OX=83333 GN=suhB PE=1 SV=1
14	P38710	8.70e-40	142	295	0.278	0.271	INM1_YEAST Inositol monophosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INM1 PE=1 SV=1
15	Q57ZU5	9.93e-40	142	283	0.292	0.297	Q57ZU5_TRYB2 Inositol-1-monophosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.720 PE=3 SV=1
16	Q05533	4.37e-39	140	292	0.278	0.274	INM2_YEAST Inositol monophosphatase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INM2 PE=1 SV=1
17	Q94F00	2.15e-37	137	371	0.281	0.218	IMPL1_ARATH Phosphatase IMPL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IMPL1 PE=1 SV=2
18	P9WKI9	7.20e-21	92.0	290	0.247	0.245	SUHB_MYCTU Inositol-1-monophosphatase SuhB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=suhB PE=1 SV=1
19	P95189	2.36e-15	76.3	260	0.253	0.281	HISN_MYCTU Histidinol-phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hisN PE=1 SV=2
20	Q6NPM8	5.66e-15	76.3	346	0.215	0.179	HIS7_ARATH Bifunctional phosphatase IMPL2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HISN7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00459 Inositol_P	5.1e-77	270.6	Inositol monophosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408526	0.976	Inositol monophosphatase 1
2	9606.ENSP00000376142	0.971	Inositol polyphosphate-1-phosphatase
3	9606.ENSP00000337746	0.965	Inositol-3-phosphate synthase 1
4	9606.ENSP00000262644	0.961	Inositol monophosphatase 3
5	9606.ENSP00000219789	0.950	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
6	9606.ENSP00000074304	0.914	Type I inositol 3,4-bisphosphate 4-phosphatase
7	9606.ENSP00000216075	0.910	Belongs to the myo-inositol oxygenase family.
8	9606.ENSP00000359423	0.907	Myotubularin
9	9606.ENSP00000425487	0.900	Type II inositol 3,4-bisphosphate 4-phosphatase
10	9606.ENSP00000334051	0.815	Guanine nucleotide-binding protein G(olf) subunit alpha
11	9606.ENSP00000430344	0.803	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
12	9606.ENSP00000360998	0.692	Ankyrin repeat domain-containing protein 22
13	9606.ENSP00000482457	0.681	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
14	9606.ENSP00000354340	0.679	NEDD8-activating enzyme E1 catalytic subunit
15	9606.ENSP00000360431	0.677	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
16	9606.ENSP00000244007	0.671	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
17	9606.ENSP00000338185	0.671	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
18	9606.ENSP00000443631	0.666	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
19	9606.ENSP00000260402	0.659	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
20	9606.ENSP00000266505	0.659	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052834	1.000	inositol monophosphate phosphatase activity
GO:0042803	0.998	protein homodimerization activity
GO:0000287	0.998	magnesium ion binding
GO:0008934	0.899	inositol monophosphate 1-phosphatase activity
GO:0031420	0.521	alkali metal ion binding
GO:0030145	0.407	manganese ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0005975	0.997	carbohydrate metabolic process
GO:0019751	0.996	polyol metabolic process
GO:0044262	0.994	cellular carbohydrate metabolic process
GO:0019637	0.716	organophosphate metabolic process
GO:0006796	0.707	phosphate-containing compound metabolic process
GO:0065007	0.619	biological regulation
GO:0050789	0.570	regulation of biological process
GO:0050896	0.558	response to stimulus
GO:0050794	0.485	regulation of cellular process
GO:0043647	0.415	inositol phosphate metabolic process
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.807	membrane-bounded organelle
GO:0043229	0.504	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24056	1.000	a myo-inositol phosphate + H2O = myo-inositol + phosphate
EC:3.1.3.25	1.000	inositol-phosphate phosphatase.
RHEA:27670	0.899	1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate

[back to server]