StarFunc result for job id O14733

User Input

>input (419 residues)
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CE90	0.939	0.740	1.642E-68	535	0.983	0.770	Q8CE90.pdb.gz	MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus OX=10090 GN=Map2k7 PE=1 SV=1
2	AFDB:D6RRB7	0.834	0.799	4.012E-60	438	0.819	0.783	D6RRB7.pdb.gz	D6RRB7_DANRE Dual specificity mitogen-activated protein kinase kinase 7 OS=Danio rerio OX=7955 GN=MKK7 PE=1 SV=1
3	AFDB:A0A2R8PW77	0.847	0.762	1.227E-57	467	0.816	0.732	A0A2R8PW77.pdb.gz
4	AFDB:Q23977	0.730	0.263	1.998E-45	1178	0.520	0.185	Q23977.pdb.gz	HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster OX=7227 GN=hep PE=1 SV=2
5	AFDB:Q21307	0.717	0.861	1.974E-40	347	0.396	0.478	Q21307.pdb.gz	MEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-1 OS=Caenorhabditis elegans OX=6239 GN=mek-1 PE=1 SV=2
6	AFDB:O61444	0.664	0.657	2.689E-36	424	0.425	0.420	O61444.pdb.gz	O61444_DROME MAP kinase kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=1 SV=1
7	AFDB:S4VP54	0.671	0.688	2.176E-35	408	0.394	0.404	S4VP54.pdb.gz	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
8	AFDB:A4UU31	0.672	0.675	2.567E-35	417	0.403	0.405	A4UU31.pdb.gz	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
9	AFDB:B1NA68	0.671	0.695	4.968E-35	404	0.408	0.423	B1NA68.pdb.gz	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
10	AFDB:G5EDF7	0.694	0.860	1.198E-34	336	0.329	0.411	G5EDF7.pdb.gz	SEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase sek-1 OS=Caenorhabditis elegans OX=6239 GN=sek-1 PE=1 SV=1
11	PDB:3eqdA	0.606	0.796	1.489E-27	315	0.284	0.378	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:8a8mB	0.603	0.831	1.614E-24	298	0.301	0.423	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
13	PDB:5eymA	0.572	0.807	8.412E-24	292	0.267	0.384	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
14	PDB:4ek6A	0.508	0.746	5.151E-17	279	0.146	0.219	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
15	PDB:4eomC	0.504	0.744	2.541E-16	276	0.165	0.250	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:4rgjA	0.506	0.462	8.525E-16	463	0.177	0.160	4rgjA.pdb.gz
17	PDB:4gcjA	0.521	0.705	1.062E-15	304	0.158	0.217	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
18	PDB:5x3fB	0.497	0.584	1.743E-15	349	0.155	0.186	5x3fB.pdb.gz
19	PDB:6s9wA	0.500	0.509	2.562E-15	411	0.172	0.175	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:4cztD	0.492	0.661	2.707E-15	302	0.174	0.242	4cztD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RRB7	0.0	683	438	0.811	0.776	D6RRB7_DANRE Dual specificity mitogen-activated protein kinase kinase 7 OS=Danio rerio OX=7955 GN=MKK7 PE=1 SV=1
2	O14733	0.0	871	419	1.000	1.000	MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2
3	Q4KSH7	0.0	865	419	0.990	0.990	MP2K7_RAT Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus OX=10116 GN=Map2k7 PE=1 SV=1
4	Q8CE90	0.0	844	535	0.983	0.770	MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus OX=10090 GN=Map2k7 PE=1 SV=1
5	Q23977	7.04e-138	425	1178	0.489	0.174	HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster OX=7227 GN=hep PE=1 SV=2
6	Q21307	3.69e-113	337	347	0.387	0.467	MEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-1 OS=Caenorhabditis elegans OX=6239 GN=mek-1 PE=1 SV=2
7	B1NA68	2.83e-100	306	404	0.375	0.389	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
8	P45985	2.71e-98	301	399	0.379	0.398	MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1
9	P47809	8.02e-98	300	397	0.375	0.395	MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus OX=10090 GN=Map2k4 PE=1 SV=2
10	Q4KSH6	8.02e-98	300	397	0.375	0.395	Q4KSH6_RAT Dual specificity mitogen-activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
11	F1LP57	8.46e-98	298	371	0.375	0.423	F1LP57_RAT Mitogen activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=4
12	A4UU31	9.52e-98	300	417	0.411	0.412	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
13	S4VP54	1.28e-97	299	408	0.375	0.385	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
14	O61444	1.09e-96	298	424	0.377	0.373	O61444_DROME MAP kinase kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=1 SV=1
15	Q7KPK6	2.22e-96	296	424	0.377	0.373	Q7KPK6_DROME JNK kinase 2 OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=2 SV=1
16	Q7KPX5	2.53e-96	296	424	0.375	0.370	Q7KPX5_DROME MAP kinase kinase 4 OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=2 SV=1
17	Q9DGE0	2.64e-91	281	361	0.332	0.385	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
18	P70236	1.09e-90	279	334	0.332	0.416	MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus OX=10090 GN=Map2k6 PE=1 SV=1
19	Q925D6	1.61e-90	278	334	0.332	0.416	Q925D6_RAT Mitogen-activated protein kinase kinase 6 OS=Rattus norvegicus OX=10116 GN=Map2k6 PE=1 SV=1
20	A8K3Y2	1.03e-89	276	334	0.327	0.410	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0076	27.0	ABC1 atypical kinase-like domain
2	PF01636 APH	1.4e+02	13.7	Phosphotransferase enzyme family
3	PF12330 Haspin_kinase	10	16.6	Haspin like kinase domain
4	PF14531 Kinase-like	0.00012	33.2	Kinase-like
5	PF00069 Pkinase	1e-52	190.7	Protein kinase domain
6	PF17667 Pkinase_fungal	13	16.0	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	1.4e-35	134.4	Protein tyrosine and serine/threonine kinase
8	PF07387 Seadorna_VP7	7.7	17.1	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10116.ENSRNOP00000058535

Rank	PPI partner	STRING score	Description
1	10116.ENSRNOP00000065176	0.998	C-Jun-amino-terminal kinase-interacting protein 1
2	10116.ENSRNOP00000003987	0.995	Mitogen-activated protein kinase 9
3	10116.ENSRNOP00000062048	0.995	Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress- activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK8/JNK1. In turn, MAPK8/JNK1 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN, JDP2 and ATF2 and thus regulates [...]
4	10116.ENSRNOP00000060904	0.994	Serine/threonine-protein kinase involved in various processes such as neuronal proliferation, differentiation, migration and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK10/JNK3. In turn, MAPK10/JNK3 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcripti [...]
5	10116.ENSRNOP00000007657	0.988	Mitogen-activated protein kinase kinase kinase 7
6	10116.ENSRNOP00000017968	0.986	Component of a protein kinase signal transduction cascade . Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4 . May phosphorylate the MAPK8/JNK1 kinase (By similarity). Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway
7	10116.ENSRNOP00000005293	0.983	Mitogen activated protein kinase kinase 4
8	10116.ENSRNOP00000007654	0.977	Mitogen activated protein kinase kinase kinase 7
9	10116.ENSRNOP00000028185	0.964	Mitogen-activated protein kinase kinase kinase 11
10	10116.ENSRNOP00000006148	0.962	TNF receptor-associated factor 6
11	10116.ENSRNOP00000052648	0.961	Mitogen-activated protein kinase 8 interacting protein 2
12	10116.ENSRNOP00000039682	0.954	Mitogen-activated protein kinase 8 interacting protein 3
13	10116.ENSRNOP00000051338	0.954	Mitogen-activated protein kinase kinase kinase 5
14	10116.ENSRNOP00000012963	0.950	Receptor-interacting serine/threonine-protein kinase 2
15	10116.ENSRNOP00000023962	0.947	Receptor (TNFRSF)-interacting serine-threonine kinase 1
16	10116.ENSRNOP00000008253	0.945	Tnf receptor-associated factor 2
17	10116.ENSRNOP00000022190	0.945	Required for lipopolysaccharide (LPS)-induced, TLR4-mediated activation of the MAPK/ERK pathway in macrophages, thus being critical for production of the proinflammatory cytokine TNF-alpha (TNF) during immune responses. Involved in the regulation of T-helper cell differentiation and IFNG expression in T-cells. Involved in mediating host resistance to bacterial infection through negative regulation of type I interferon (IFN) production. Transduces CD40 and TNFRSF1A signals that activate ERK in B-cells and macrophages, and thus may play a role in the regulation of immunoglobulin producti [...]
18	10116.ENSRNOP00000020437	0.943	Part of a non-canonical MAPK signaling pathway. Activated by APOE, enhances the AP-1-mediated transcription of APP, via a MAP kinase signal transduction pathway composed of MAP2K7 and MAPK1/ERK2 and MAPK3/ERK1. May be an activator of the JNK/SAPK pathway.
19	10116.ENSRNOP00000031328	0.941	Mitogen activated protein kinase kinase kinase 10
20	10116.ENSRNOP00000061751	0.939	Interleukin-1 receptor-associated kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004708	0.998	MAP kinase kinase activity
GO:0019899	0.996	enzyme binding
GO:0043167	0.995	ion binding
GO:0004674	0.951	protein serine/threonine kinase activity
GO:0000287	0.598	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.989	positive regulation of biological process
GO:0007165	0.986	signal transduction
GO:0006950	0.983	response to stress
GO:0048522	0.979	positive regulation of cellular process
GO:0048583	0.977	regulation of response to stimulus
GO:0000165	0.975	MAPK cascade
GO:0033554	0.974	cellular response to stress
GO:0043408	0.970	regulation of MAPK cascade
GO:0042221	0.957	response to chemical
GO:0051403	0.957	stress-activated MAPK cascade
GO:0019222	0.951	regulation of metabolic process
GO:0043410	0.936	positive regulation of MAPK cascade
GO:0007254	0.929	JNK cascade
GO:0010033	0.924	response to organic substance
GO:0008152	0.882	metabolic process
GO:0060255	0.874	regulation of macromolecule metabolic process
GO:0044238	0.839	primary metabolic process
GO:0051171	0.813	regulation of nitrogen compound metabolic process
GO:0071704	0.808	organic substance metabolic process
GO:0032874	0.791	positive regulation of stress-activated MAPK cascade
GO:0044237	0.788	cellular metabolic process
GO:0051247	0.782	positive regulation of protein metabolic process
GO:0043170	0.769	macromolecule metabolic process
GO:0032502	0.767	developmental process
GO:0006807	0.735	nitrogen compound metabolic process
GO:0031323	0.718	regulation of cellular metabolic process
GO:0032501	0.711	multicellular organismal process
GO:0009628	0.710	response to abiotic stimulus
GO:0031325	0.708	positive regulation of cellular metabolic process
GO:0070887	0.706	cellular response to chemical stimulus
GO:0031401	0.700	positive regulation of protein modification process
GO:0010941	0.668	regulation of cell death
GO:1901564	0.667	organonitrogen compound metabolic process
GO:0043067	0.643	regulation of programmed cell death
GO:0048856	0.642	anatomical structure development
GO:0071310	0.629	cellular response to organic substance
GO:0007275	0.589	multicellular organism development
GO:0051174	0.579	regulation of phosphorus metabolic process
GO:0042981	0.553	regulation of apoptotic process
GO:1901700	0.500	response to oxygen-containing compound
GO:0019219	0.449	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.422	negative regulation of biological process
GO:0019538	0.410	protein metabolic process
GO:0006468	0.403	protein phosphorylation
GO:0048523	0.402	negative regulation of cellular process
GO:0042325	0.373	regulation of phosphorylation
GO:0043065	0.327	positive regulation of apoptotic process
GO:0009889	0.318	regulation of biosynthetic process
GO:0048731	0.316	system development
GO:0065009	0.312	regulation of molecular function
GO:0001932	0.300	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.941	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.12.2	0.998	mitogen-activated protein kinase kinase.

[back to server]