StarFunc result for job id O14735

User Input

>input (213 residues)
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG
TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH
KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA
PIALLKSLISVIHLITAARNMAALDAADRAKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14735	1.000	1.000	3.538E-28	213	1.000	1.000	O14735.pdb.gz	CDIPT_HUMAN CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT PE=1 SV=1
2	AFDB:Q6DRN8	0.946	0.946	5.261E-20	213	0.695	0.695	Q6DRN8.pdb.gz
3	AFDB:Q8SX37	0.933	0.888	1.433E-15	224	0.502	0.478	Q8SX37.pdb.gz	CDIPT_DROME CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Drosophila melanogaster OX=7227 GN=Pis PE=1 SV=1
4	AFDB:Q10153	0.946	0.853	1.930E-14	237	0.446	0.401	Q10153.pdb.gz	PIS_SCHPO CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pis1 PE=3 SV=2
5	AFDB:Q59RA2	0.919	0.853	2.687E-14	230	0.455	0.422	Q59RA2.pdb.gz	PIS_CANAL CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIS1 PE=1 SV=1
6	AFDB:P06197	0.907	0.879	1.495E-12	220	0.385	0.373	P06197.pdb.gz	PIS_YEAST CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIS1 PE=1 SV=1
7	AFDB:Q38FY6	0.855	0.840	1.105E-10	217	0.362	0.355	Q38FY6.pdb.gz	Q38FY6_TRYB2 CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0530 PE=3 SV=1
8	AFDB:Q8GUK6	0.853	0.810	2.071E-9	225	0.333	0.316	Q8GUK6.pdb.gz	PIS2_ARATH Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=PIS2 PE=2 SV=2
9	AFDB:C0H5B7	0.875	0.891	3.024E-9	209	0.300	0.306	C0H5B7.pdb.gz	C0H5B7_PLAF7 CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1315600 PE=3 SV=1
10	AFDB:Q8LBA6	0.845	0.795	4.414E-9	227	0.324	0.304	Q8LBA6.pdb.gz	PIS1_ARATH CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIS1 PE=1 SV=2
11	PDB:6h5aB	0.494	0.501	9.186E-3	209	0.155	0.158	6h5aB.pdb.gz	Structure ofMycobacterium tuberculosisphosphatidylinositol phosphate synthase reveals mechanism of substrate binding and metal catalysis.
12	PDB:1h2sA	0.300	0.288	7.115E-1	225	0.122	0.116	1h2sA.pdb.gz	Molecular Basis of Transmembrane Signalling by Sensory Rhodopsin II-Transducer Complex
13	PDB:6ov2A	0.181	0.205	1.039	182	0.103	0.121	6ov2A.pdb.gz
14	PDB:7f3tA	0.308	0.223	1.039	330	0.136	0.088	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.
15	PDB:5nbdA	0.176	0.098	1.379	564	0.183	0.069	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
16	PDB:6oz6D	0.161	0.129	1.379	288	0.146	0.108	6oz6D.pdb.gz	Chemical logic of MraY inhibition by antibacterial nucleoside natural products.
17	PDB:7d3eB	0.186	0.154	1.666	272	0.108	0.085	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
18	PDB:7qa8B	0.251	0.208	1.747	299	0.146	0.104	7qa8B.pdb.gz	Activation mechanism of the class D fungal GPCR dimer Ste2.
19	PDB:7exdR	0.232	0.200	2.013	272	0.141	0.110	7exdR.pdb.gz	Structural basis for recognition of anti-migraine drug lasmiditan by the serotonin receptor 5-HT 1F -G protein complex.
20	PDB:6al2A	0.161	0.094	2.111	484	0.061	0.027	6al2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14735	1.03e-156	434	213	1.000	1.000	CDIPT_HUMAN CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT PE=1 SV=1
2	P70500	5.31e-151	419	213	0.953	0.953	CDIPT_RAT CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Rattus norvegicus OX=10116 GN=Cdipt PE=1 SV=1
3	Q6NYP5	1.57e-104	301	213	0.700	0.700	Q6NYP5_DANRE CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Danio rerio OX=7955 GN=zgc:77540 PE=1 SV=1
4	Q8SX37	3.88e-69	212	224	0.502	0.478	CDIPT_DROME CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Drosophila melanogaster OX=7227 GN=Pis PE=1 SV=1
5	Q59RA2	9.62e-61	191	230	0.465	0.430	PIS_CANAL CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PIS1 PE=1 SV=1
6	Q10153	5.09e-55	177	237	0.446	0.401	PIS_SCHPO CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pis1 PE=3 SV=2
7	P06197	3.21e-44	149	220	0.394	0.382	PIS_YEAST CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIS1 PE=1 SV=1
8	Q38FY6	1.20e-32	119	217	0.366	0.359	Q38FY6_TRYB2 CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0530 PE=3 SV=1
9	Q8GUK6	4.61e-31	115	225	0.333	0.316	PIS2_ARATH Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=PIS2 PE=2 SV=2
10	Q8LBA6	9.79e-31	114	227	0.338	0.317	PIS1_ARATH CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIS1 PE=1 SV=2
11	C0H5B7	4.22e-26	102	209	0.291	0.297	C0H5B7_PLAF7 CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1315600 PE=3 SV=1
12	P0ABF8	4.50e-06	47.8	182	0.113	0.132	PGSA_ECOLI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pgsA PE=1 SV=2
13	O13899	5.81e-06	48.5	570	0.136	0.051	CRLS1_SCHPO Cardiolipin synthase (CMP-forming) / mitochondrial hydrolase fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crd1 PE=1 SV=2
14	Q93YW7	1.12e-04	44.3	341	0.141	0.088	CLS_ARATH Cardiolipin synthase (CMP-forming), mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLS PE=1 SV=1
15	Q8U1Z6	0.005	39.7	430	0.117	0.058	DIPPS_PYRFU Bifunctional IPC transferase and DIPP synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=PF1058 PE=1 SV=1
16	O29976	0.006	39.3	490	0.113	0.049	DIPPS_ARCFU Bifunctional IPC transferase and DIPP synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=AF_0263 PE=1 SV=1
17	O67379	0.008	38.9	428	0.108	0.054	DIPPS_AQUAE Bifunctional IPC transferase and DIPP synthase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=spsI PE=1 SV=1
18	P9WPG7	0.074	35.4	217	0.085	0.083	PIPS_MYCTU Phosphatidylinositol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgsA1 PE=1 SV=1
19	Q9M2W3	0.089	35.4	233	0.094	0.086	PGPS2_ARATH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=PGPS2 PE=1 SV=1
20	O80952	0.13	35.0	296	0.099	0.071	PGPS1_ARATH CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGPS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01066 CDP-OH_P_transf	1e-11	57.1	CDP-alcohol phosphatidyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219789

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295887	0.988	Phosphatidate cytidylyltransferase 1
2	9606.ENSP00000419879	0.985	Phosphatidate cytidylyltransferase 2
3	9606.ENSP00000262764	0.973	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
4	9606.ENSP00000373713	0.970	Phosphatidylinositide phosphatase SAC1
5	9606.ENSP00000255882	0.959	Phosphatidylinositol 4-kinase alpha
6	9606.ENSP00000357869	0.955	Phosphatidylinositol 4-kinase beta
7	9606.ENSP00000368140	0.954	Cardiolipin synthase (CMP-forming)
8	9606.ENSP00000269159	0.950	Inositol monophosphatase 2
9	9606.ENSP00000408526	0.949	Inositol monophosphatase 1
10	9606.ENSP00000264380	0.945	1-phosphatidylinositol 3-phosphate 5-kinase
11	9606.ENSP00000262039	0.939	Phosphatidylinositol 3-kinase catalytic subunit type 3
12	9606.ENSP00000264864	0.932	Phosphatidylinositol 4-kinase type 2-beta
13	9606.ENSP00000359665	0.927	Phosphatidylinositol 4-kinase type 2-alpha
14	9606.ENSP00000216075	0.925	Belongs to the myo-inositol oxygenase family.
15	9606.ENSP00000356155	0.923	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
16	9606.ENSP00000180173	0.922	Myotubularin-related protein 7
17	9606.ENSP00000359423	0.922	Myotubularin
18	9606.ENSP00000345752	0.921	Myotubularin-related protein 2
19	9606.ENSP00000359417	0.919	Myotubularin-related protein 1
20	9606.ENSP00000296003	0.918	Myotubularin-related protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003881	0.999	CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity
GO:0005488	0.995	binding
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008654	0.995	phospholipid biosynthetic process
GO:0006661	0.987	phosphatidylinositol biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.996	organelle membrane
GO:0042175	0.986	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.985	organelle subcompartment
GO:0005789	0.980	endoplasmic reticulum membrane
GO:0005829	0.596	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11580	0.999	a CDP-1,2-diacyl-sn-glycerol + myo-inositol = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + CMP + H(+)
EC:2.7.8.11	0.999	CDP-diacylglycerol--inositol 3-phosphatidyltransferase.

[back to server]