StarFunc result for job id O14737

User Input

>input (125 residues)
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLA
LVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSD
EDDDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14737	1.000	1.000	1.388E-17	125	1.000	1.000	O14737.pdb.gz	PDCD5_HUMAN Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3
2	AFDB:Q9VUZ8	0.623	0.589	6.470E-8	133	0.448	0.421	Q9VUZ8.pdb.gz	Q9VUZ8_DROME GEO07442p1 OS=Drosophila melanogaster OX=7227 GN=PDCD-5 PE=1 SV=1
3	AFDB:F4I354	0.518	0.474	9.135E-7	138	0.344	0.312	F4I354.pdb.gz	F4I354_ARATH Double-stranded DNA-binding family protein OS=Arabidopsis thaliana OX=3702 GN=PDCD5 PE=1 SV=2
4	AFDB:Q8I359	0.567	0.546	1.077E-5	131	0.296	0.282	Q8I359.pdb.gz	Q8I359_PLAF7 Apoptosis-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0909300 PE=3 SV=2
5	AFDB:Q04773	0.469	0.408	2.054E-4	145	0.280	0.241	Q04773.pdb.gz	YMW4_YEAST Uncharacterized protein YMR074C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR074C PE=1 SV=1
6	PDB:3ctwB	0.200	0.207	1.923	120	0.088	0.092	3ctwB.pdb.gz
7	AFDB:Q96SQ7	0.264	0.130	1.925	321	0.176	0.069	Q96SQ7.pdb.gz	ATOH8_HUMAN Transcription factor ATOH8 OS=Homo sapiens OX=9606 GN=ATOH8 PE=1 SV=2
8	PDB:6dv9F	0.308	0.243	2.931	174	0.056	0.040	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
9	AFDB:O08836	0.196	0.077	2.933	340	0.088	0.032	O08836.pdb.gz	IGBP1_RAT Immunoglobulin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igbp1 PE=2 SV=2
10	PDB:1wn0C	0.229	0.213	3.510	138	0.184	0.167	1wn0C.pdb.gz
11	PDB:6fhsC	0.298	0.102	3.510	459	0.096	0.026	6fhsC.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
12	AFDB:Q9C6K9	0.214	0.056	3.514	629	0.072	0.014	Q9C6K9.pdb.gz	LRL11_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1 OS=Arabidopsis thaliana OX=3702 GN=LRK10L-1.1 PE=2 SV=1
13	AFDB:Q9Z515	0.204	0.115	3.514	328	0.184	0.070	Q9Z515.pdb.gz	WHIA_STRCO Probable cell division protein WhiA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=whiA PE=1 SV=1
14	AFDB:Q8WV07	0.225	0.210	4.470	137	0.176	0.161	Q8WV07.pdb.gz	LTO1_HUMAN Protein LTO1 homolog OS=Homo sapiens OX=9606 GN=LTO1 PE=1 SV=2
15	PDB:2c9oA	0.249	0.100	5.681	398	0.088	0.028	2c9oA.pdb.gz	Crystal structure of the human AAA+ protein RuvBL1.
16	PDB:5fm7B	0.238	0.091	6.033	422	0.088	0.026	5fm7B.pdb.gz	The Combination of X-Ray Crystallography and Cryo-Electron Microscopy Provides Insight Into the Overall Architecture of the Dodecameric Rvb1/Rvb2 Complex.
17	PDB:7tveD	0.237	0.091	6.033	445	0.152	0.043	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
18	PDB:3glfE	0.193	0.085	6.407	334	0.040	0.015	3glfE.pdb.gz	The mechanism of ATP-dependent primer-template recognition by a clamp loader complex.
19	PDB:3hybA	0.150	0.160	6.407	115	0.104	0.113	3hybA.pdb.gz
20	PDB:5iy7M	0.214	0.112	7.227	310	0.096	0.039	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14737	1.09e-87	252	125	1.000	1.000	PDCD5_HUMAN Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3
2	Q9VUZ8	7.27e-27	98.6	133	0.448	0.421	Q9VUZ8_DROME GEO07442p1 OS=Drosophila melanogaster OX=7227 GN=PDCD-5 PE=1 SV=1
3	F4I354	1.91e-17	74.7	138	0.360	0.326	F4I354_ARATH Double-stranded DNA-binding family protein OS=Arabidopsis thaliana OX=3702 GN=PDCD5 PE=1 SV=2
4	Q04773	3.87e-09	53.1	145	0.296	0.255	YMW4_YEAST Uncharacterized protein YMR074C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR074C PE=1 SV=1
5	Q8I359	5.34e-06	44.7	131	0.232	0.221	Q8I359_PLAF7 Apoptosis-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0909300 PE=3 SV=2
6	Q9UKT9	4.0	29.3	509	0.160	0.039	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
7	G3MZY8	8.6	28.5	1970	0.136	0.009	G3MZY8_BOVIN DNA-directed RNA polymerase subunit OS=Bos taurus OX=9913 GN=POLR2A PE=1 SV=2
8	P24928	8.6	28.5	1970	0.136	0.009	RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2
9	A0A8I6ASE2	8.7	28.5	1956	0.136	0.009	A0A8I6ASE2_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
10	D4A5A6	8.7	28.5	1970	0.136	0.009	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
11	P08775	8.8	28.5	1970	0.136	0.009	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3
12	P07550	9.0	28.1	413	0.120	0.036	ADRB2_HUMAN Beta-2 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB2 PE=1 SV=3
13	P11047	9.3	28.1	1609	0.168	0.013	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01984 dsDNA_bind	1.4e-29	113.9	Double-stranded DNA-binding domain
2	PF12644 DUF3782	1.5e+02	13.9	Protein of unknown function (DUF3782)
3	PF10587 EF-1_beta_acid	1.2e+02	14.5	Eukaryotic elongation factor 1 beta central acidic region
4	PF05119 Terminase_4	42	16.0	Phage terminase, small subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001140

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001812	0.831	Prefoldin subunit 5
2	60711.ENSCSAP00000005817	0.772	Prefoldin subunit 6
3	60711.ENSCSAP00000004254	0.730	K(lysine) acetyltransferase 5
4	60711.ENSCSAP00000007046	0.716	Polysaccharide biosynthesis domain containing 1
5	60711.ENSCSAP00000006983	0.673	Transglutaminase 3
6	60711.ENSCSAP00000006104	0.666	Ribosomal protein L36a-like
7	60711.ENSCSAP00000011362	0.666	annotation not available
8	60711.ENSCSAP00000007551	0.664	Acts as a tumor suppressor in many tumor types
9	60711.ENSCSAP00000018574	0.661	Neural precursor cell expressed, developmentally down-regulated 8
10	60711.ENSCSAP00000015334	0.659	Transcription factor 25 (basic helix-loop-helix)
11	60711.ENSCSAP00000015350	0.647	Dysbindin (dystrobrevin binding protein 1) domain containing 1
12	60711.ENSCSAP00000015352	0.635	Growth arrest-specific 8
13	60711.ENSCSAP00000009174	0.632	General transcription factor IIH, polypeptide 5
14	60711.ENSCSAP00000002801	0.630	annotation not available
15	60711.ENSCSAP00000011486	0.630	annotation not available
16	60711.ENSCSAP00000017870	0.630	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins
17	60711.ENSCSAP00000014902	0.627	Methenyltetrahydrofolate synthetase domain containing
18	60711.ENSCSAP00000011248	0.618	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
19	60711.ENSCSAP00000017627	0.618	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
20	60711.ENSCSAP00000000197	0.588	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098772	1.000	molecular function regulator activity
GO:0005515	1.000	protein binding
GO:0008047	0.994	enzyme activator activity
GO:0048487	0.993	beta-tubulin binding
GO:0008201	0.989	heparin binding
GO:0010698	0.950	acetyltransferase activator activity
GO:0097159	0.712	organic cyclic compound binding
GO:0003676	0.700	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048519	0.982	negative regulation of biological process
GO:0048518	0.973	positive regulation of biological process
GO:0019222	0.973	regulation of metabolic process
GO:0050896	0.957	response to stimulus
GO:0065009	0.945	regulation of molecular function
GO:0030162	0.939	regulation of proteolysis
GO:0048522	0.895	positive regulation of cellular process
GO:0048523	0.883	negative regulation of cellular process
GO:0009893	0.830	positive regulation of metabolic process
GO:0009987	0.807	cellular process
GO:0051128	0.686	regulation of cellular component organization
GO:0051173	0.667	positive regulation of nitrogen compound metabolic process
GO:0010604	0.655	positive regulation of macromolecule metabolic process
GO:0010468	0.604	regulation of gene expression
GO:0071704	0.506	organic substance metabolic process
GO:0044238	0.497	primary metabolic process
GO:0050790	0.496	regulation of catalytic activity
GO:0044237	0.492	cellular metabolic process
GO:0006807	0.455	nitrogen compound metabolic process
GO:0043170	0.430	macromolecule metabolic process
GO:0033043	0.427	regulation of organelle organization
GO:0032879	0.409	regulation of localization
GO:0051247	0.375	positive regulation of protein metabolic process
GO:0044093	0.367	positive regulation of molecular function
GO:0060341	0.367	regulation of cellular localization
GO:0010941	0.359	regulation of cell death
GO:0032880	0.352	regulation of protein localization
GO:0043067	0.321	regulation of programmed cell death
GO:1903829	0.319	positive regulation of protein localization
GO:0010638	0.317	positive regulation of organelle organization
GO:0042981	0.308	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070062	0.995	extracellular exosome
GO:0070013	0.969	intracellular organelle lumen
GO:0005829	0.967	cytosol
GO:0032991	0.944	protein-containing complex
GO:0031981	0.703	nuclear lumen
GO:0005654	0.512	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]