StarFunc result for job id O14744

User Input

>input (637 residues)
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4g56A	0.913	0.942	0.000	617	0.823	0.849	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
2	PDB:6ughA	0.919	0.985	0.000	594	0.931	0.998	6ughA.pdb.gz
3	PDB:7bo7AAA	0.961	0.979	0.000	625	0.981	1.000	7bo7AAA.pdb.gz	CRYSTAL STRUCTURE OF THE HUMAN PRMT5:MEP50 COMPLEX with JNJB44355437
4	AFDB:B0R026	0.970	0.979	0.000	631	0.785	0.792	B0R026.pdb.gz
5	AFDB:D4A0E8	0.973	0.973	0.000	637	0.978	0.978	D4A0E8.pdb.gz	D4A0E8_RAT Protein arginine N-methyltransferase 5 OS=Rattus norvegicus OX=10116 GN=Prmt5 PE=3 SV=1
6	AFDB:Q6NUA1	0.972	0.978	0.000	633	0.834	0.839	Q6NUA1.pdb.gz	ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis OX=8355 GN=prmt5 PE=1 SV=1
7	AFDB:Q8GWT4	0.915	0.908	5.476E-84	642	0.460	0.456	Q8GWT4.pdb.gz	ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana OX=3702 GN=PMRT15 PE=1 SV=2
8	AFDB:Q54KI3	0.918	0.911	7.521E-83	642	0.460	0.456	Q54KI3.pdb.gz	ANM5_DICDI Protein arginine N-methyltransferase 5 OS=Dictyostelium discoideum OX=44689 GN=prmt5 PE=3 SV=1
9	AFDB:Q9U6Y9	0.896	0.934	3.468E-77	610	0.375	0.392	Q9U6Y9.pdb.gz	ANM5_DROME Protein arginine N-methyltransferase 5 OS=Drosophila melanogaster OX=7227 GN=csul PE=1 SV=2
10	AFDB:P78963	0.872	0.862	3.909E-68	645	0.349	0.344	P78963.pdb.gz	SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=skb1 PE=1 SV=2
11	AFDB:P46580	0.854	0.747	2.376E-67	734	0.352	0.305	P46580.pdb.gz	ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=prmt-5 PE=1 SV=2
12	AFDB:Q8ID96	0.825	0.729	4.012E-67	724	0.330	0.290	Q8ID96.pdb.gz	Q8ID96_PLAF7 Protein arginine N-methyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1361000 PE=3 SV=1
13	AFDB:Q5BH46	0.842	0.636	1.861E-63	851	0.383	0.287	Q5BH46.pdb.gz	Q5BH46_EMENI Protein arginine N-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00134 PE=3 SV=1
14	PDB:3ua3A	0.492	0.474	5.604E-60	662	0.339	0.326	3ua3A.pdb.gz	Structural insights into protein arginine symmetric dimethylation by PRMT5
15	PDB:3ua4A	0.460	0.458	1.881E-55	640	0.312	0.311	3ua4A.pdb.gz
16	PDB:4c4aA	0.387	0.385	2.617E-18	641	0.082	0.081	4c4aA.pdb.gz	Structural Insight Into Arginine Methylation by the Mouse Protein Arginine Methyltransferase 7: A Zinc Finger Freezes the Mimic of the Dimeric State Into a Single Active Site.
17	PDB:4y2hB	0.391	0.677	6.644E-18	352	0.094	0.170	4y2hB.pdb.gz	Aryl Pyrazoles as Potent Inhibitors of Arginine Methyltransferases: Identification of the First PRMT6 Tool Compound.
18	PDB:6nt2A	0.386	0.705	6.644E-18	330	0.094	0.182	6nt2A.pdb.gz	Anti-tumor Activity of the Type I PRMT Inhibitor, GSK3368715, Synergizes with PRMT5 Inhibition through MTAP Loss.
19	PDB:6dnzA	0.399	0.764	1.416E-17	317	0.086	0.174	6dnzA.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
20	PDB:1g6q1	0.388	0.713	4.281E-17	328	0.089	0.174	1g6q1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZP89	0.0	1150	577	0.865	0.955	A0A8I5ZP89_RAT Protein arginine N-methyltransferase 5 OS=Rattus norvegicus OX=10116 GN=Prmt5 PE=1 SV=1
2	A0A8I6ANJ2	0.0	1231	615	0.936	0.969	A0A8I6ANJ2_RAT Protein arginine N-methyltransferase 5 OS=Rattus norvegicus OX=10116 GN=Prmt5 PE=1 SV=1
3	D4A0E8	0.0	1309	637	0.978	0.978	D4A0E8_RAT Protein arginine N-methyltransferase 5 OS=Rattus norvegicus OX=10116 GN=Prmt5 PE=3 SV=1
4	O14744	0.0	1333	637	1.000	1.000	ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4
5	Q503E3	0.0	1063	631	0.779	0.786	Q503E3_DANRE Protein arginine N-methyltransferase 5 OS=Danio rerio OX=7955 GN=si:zc14a17.2 PE=1 SV=1
6	Q54KI3	0.0	544	642	0.465	0.461	ANM5_DICDI Protein arginine N-methyltransferase 5 OS=Dictyostelium discoideum OX=44689 GN=prmt5 PE=3 SV=1
7	Q6NUA1	0.0	1147	633	0.834	0.839	ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis OX=8355 GN=prmt5 PE=1 SV=1
8	Q8CIG8	0.0	1308	637	0.978	0.978	ANM5_MOUSE Protein arginine N-methyltransferase 5 OS=Mus musculus OX=10090 GN=Prmt5 PE=1 SV=3
9	Q8GWT4	0.0	565	642	0.465	0.461	ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana OX=3702 GN=PMRT15 PE=1 SV=2
10	Q9U6Y9	3.84e-141	426	610	0.375	0.392	ANM5_DROME Protein arginine N-methyltransferase 5 OS=Drosophila melanogaster OX=7227 GN=csul PE=1 SV=2
11	P78963	3.08e-119	370	645	0.347	0.343	SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=skb1 PE=1 SV=2
12	Q8ID96	6.49e-102	328	724	0.334	0.294	Q8ID96_PLAF7 Protein arginine N-methyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1361000 PE=3 SV=1
13	Q5BH46	8.90e-101	328	851	0.392	0.294	Q5BH46_EMENI Protein arginine N-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00134 PE=3 SV=1
14	P46580	1.57e-98	319	734	0.345	0.300	ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=prmt-5 PE=1 SV=2
15	P38274	1.19e-69	244	827	0.290	0.224	HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSL7 PE=1 SV=1
16	Q38CH6	1.27e-40	160	784	0.264	0.214	Q38CH6_TRYB2 Methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7570 PE=4 SV=1
17	Q7Q2B7	1.96e-08	59.7	622	0.105	0.108	CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae OX=7165 GN=CARM1 PE=1 SV=5
18	Q9VH48	6.68e-08	57.8	530	0.115	0.138	CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster OX=7227 GN=Art4 PE=1 SV=1
19	Q8SX32	5.31e-07	54.3	341	0.072	0.135	Q8SX32_DROME Arginine methyltransferase 8 OS=Drosophila melanogaster OX=7227 GN=Art8 PE=1 SV=1
20	A0A0S2Z3N3	8.54e-07	54.3	433	0.119	0.176	A0A0S2Z3N3_HUMAN Protein arginine methyltransferase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRMT2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13649 Methyltransf_25	64	15.7	Methyltransferase domain
2	PF02475 Met_10	23	16.2	Met-10+ like-protein
3	PF05175 MTS	15	16.6	Methyltransferase small domain
4	PF05185 PRMT5	3.9e-69	243.4	PRMT5 arginine-N-methyltransferase
5	PF17286 PRMT5_C	2.6e-56	201.8	PRMT5 oligomerisation domain
6	PF17285 PRMT5_TIM	3.7e-73	257.5	PRMT5 TIM barrel domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005560876.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005542417.1	0.999	Methylosome protein 50
2	9541.XP_005579228.1	0.991	Uncharacterized protein
3	9541.XP_005587114.1	0.988	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA
4	9541.XP_005592406.1	0.958	Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3)
5	9541.XP_005554278.1	0.956	Belongs to the histone H2B family.
6	9541.XP_005554277.1	0.951	Uncharacterized protein LOC102117724
7	9541.XP_005554279.1	0.951	Uncharacterized protein LOC102120371
8	9541.XP_005588043.1	0.948	Uncharacterized protein
9	9541.XP_005554151.1	0.946	Serine/threonine-protein kinase RIO1 isoform X1
10	9541.XP_005584163.1	0.937	BRG1-associated factor 57
11	9541.XP_005567840.1	0.936	Small nuclear ribonucleoprotein Sm D3 isoform X1
12	9541.XP_005553868.1	0.931	annotation not available
13	9541.XP_005583425.1	0.931	Protein TTP1
14	9541.XP_005590001.1	0.922	Protein arginine N-methyltransferase 1 isoform X1
15	9541.XP_005568579.1	0.921	Small nuclear ribonucleoprotein-associated proteins B and B' isoform X1
16	9541.XP_005578449.1	0.921	Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family.
17	9541.XP_005570272.1	0.920	Histone H4-like
18	9541.XP_005553801.1	0.913	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity)
19	9541.XP_005553865.1	0.913	Histone H4-like
20	9541.XP_005553874.1	0.913	Histone H4-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042054	0.999	histone methyltransferase activity
GO:0016274	0.999	protein-arginine N-methyltransferase activity
GO:0005515	0.997	protein binding
GO:0044877	0.990	protein-containing complex binding
GO:0008469	0.899	histone arginine N-methyltransferase activity
GO:1901363	0.680	heterocyclic compound binding
GO:0097159	0.680	organic cyclic compound binding
GO:0035243	0.663	protein-arginine omega-N symmetric methyltransferase activity
GO:0003676	0.406	nucleic acid binding
GO:0140939	0.368	histone H4 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0008152	0.977	metabolic process
GO:0043170	0.965	macromolecule metabolic process
GO:0065007	0.952	biological regulation
GO:0044238	0.942	primary metabolic process
GO:0044237	0.940	cellular metabolic process
GO:0050789	0.931	regulation of biological process
GO:0006479	0.931	protein methylation
GO:0050794	0.907	regulation of cellular process
GO:0071840	0.703	cellular component organization or biogenesis
GO:0016043	0.673	cellular component organization
GO:0019222	0.447	regulation of metabolic process
GO:0060255	0.431	regulation of macromolecule metabolic process
GO:0031100	0.401	animal organ regeneration
GO:0051171	0.362	regulation of nitrogen compound metabolic process
GO:0080090	0.357	regulation of primary metabolic process
GO:0032501	0.341	multicellular organismal process
GO:0045595	0.323	regulation of cell differentiation
GO:0010646	0.312	regulation of cell communication
GO:0048523	0.306	negative regulation of cellular process
GO:0023051	0.304	regulation of signaling
GO:0048518	0.302	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.987	nucleoplasm
GO:1902494	0.966	catalytic complex
GO:0005737	0.966	cytoplasm
GO:0140513	0.907	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.
RHEA:48108	0.663	L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)'-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine
EC:2.1.1.320	0.663	type II protein arginine methyltransferase.

[back to server]