StarFunc result for job id O14753

User Input

>input (267 residues)
MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLA
LNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTC
RVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD
KAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP
LLRKTSKKVAVALQNTVTSLLQGSPHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14753	1.000	1.000	1.947E-47	267	1.000	1.000	O14753.pdb.gz	OVOL1_HUMAN Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3
2	AFDB:F8W4G4	0.352	0.298	5.723E-24	319	0.562	0.470	F8W4G4.pdb.gz	F8W4G4_DANRE Ovo-like zinc finger 1a OS=Danio rerio OX=7955 GN=ovol1 PE=4 SV=1
3	AFDB:G5EDU6	0.343	0.330	5.584E-20	280	0.386	0.368	G5EDU6.pdb.gz	OVOLH_CAEEL Transcription factor ovo-like homolog lin-48 OS=Caenorhabditis elegans OX=6239 GN=lin-48 PE=1 SV=1
4	AFDB:Q86UD4	0.321	0.167	4.684E-12	541	0.247	0.122	Q86UD4.pdb.gz	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
5	AFDB:Q99MD8	0.302	0.141	4.684E-12	610	0.277	0.121	Q99MD8.pdb.gz	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
6	AFDB:Q02975	0.290	0.140	4.990E-12	576	0.232	0.108	Q02975.pdb.gz	Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus OX=10116 GN=Znf354a PE=2 SV=1
7	AFDB:Q8TF45	0.296	0.133	9.402E-12	676	0.225	0.089	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
8	AFDB:Q9BSG1	0.282	0.183	9.402E-12	425	0.228	0.144	Q9BSG1.pdb.gz	ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens OX=9606 GN=ZNF2 PE=1 SV=5
9	AFDB:Q8TF47	0.273	0.122	1.067E-11	636	0.213	0.090	Q8TF47.pdb.gz	ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2
10	AFDB:Q9NQZ8	0.292	0.165	1.211E-11	489	0.243	0.133	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
11	PDB:3w5kB	0.157	0.268	4.441E-5	110	0.142	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.063	0.200	7.193E-1	62	0.056	0.242	6ydhA.pdb.gz
13	PDB:7uhyA	0.079	0.034	1.052	771	0.082	0.029	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:5apny	0.097	0.123	1.272	211	0.075	0.095	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
15	PDB:7ksrC	0.108	0.080	1.272	397	0.064	0.043	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	PDB:6t9lN	0.115	0.322	1.444	82	0.064	0.207	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
17	PDB:5dkaA	0.097	0.224	1.538	96	0.060	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:7pt6I	0.090	0.076	2.250	341	0.101	0.079	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
19	PDB:7uhyC	0.074	0.036	2.899	578	0.056	0.026	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:7pfoB	0.078	0.037	3.735	759	0.075	0.026	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14753	0.0	554	267	1.000	1.000	OVOL1_HUMAN Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3
2	Q9WTJ2	0.0	532	267	0.955	0.955	OVOL1_MOUSE Putative transcription factor Ovo-like 1 OS=Mus musculus OX=10090 GN=Ovol1 PE=2 SV=1
3	F8W4G4	1.70e-92	277	319	0.584	0.489	F8W4G4_DANRE Ovo-like zinc finger 1a OS=Danio rerio OX=7955 GN=ovol1 PE=4 SV=1
4	Q8CIV7	1.90e-87	263	274	0.543	0.529	OVOL2_MOUSE Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=1 SV=2
5	Q9BRP0	8.18e-87	261	275	0.532	0.516	OVOL2_HUMAN Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1
6	A9JSU5	1.11e-71	222	256	0.453	0.473	A9JSU5_DANRE Transcription factor Ovo-like 1 OS=Danio rerio OX=7955 GN=ovol1 PE=2 SV=1
7	P51521	1.47e-62	214	1351	0.375	0.074	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
8	A7E2L3	8.50e-62	197	253	0.330	0.348	A7E2L3_DANRE Uncharacterized protein LOC100124596 OS=Danio rerio OX=7955 GN=zgc:171929 PE=2 SV=1
9	G5EDU6	6.41e-59	190	280	0.315	0.300	OVOLH_CAEEL Transcription factor ovo-like homolog lin-48 OS=Caenorhabditis elegans OX=6239 GN=lin-48 PE=1 SV=1
10	Q99MD8	1.43e-21	95.9	610	0.210	0.092	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
11	Q9NPC7	4.88e-21	94.4	610	0.206	0.090	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
12	Q60821	3.48e-19	89.0	794	0.180	0.060	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
13	Q13105	1.17e-18	87.4	803	0.176	0.059	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
14	G5EDE1	1.97e-18	85.5	336	0.165	0.131	GFI1H_CAEEL Zinc finger protein GFI1 homolog pag-3 OS=Caenorhabditis elegans OX=6239 GN=pag-3 PE=1 SV=1
15	P98182	4.22e-17	82.4	395	0.172	0.116	ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens OX=9606 GN=ZNF200 PE=1 SV=2
16	Q15776	7.47e-17	82.0	578	0.199	0.092	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
17	Q9H7X3	7.63e-17	81.3	374	0.161	0.115	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
18	F1QWQ9	7.76e-17	82.0	568	0.157	0.074	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1
19	Q6XSK8	9.01e-17	81.6	517	0.157	0.081	Q6XSK8_DANRE PR domain zinc finger protein 14 OS=Danio rerio OX=7955 GN=wu:fc16b12 PE=4 SV=2
20	Q9UL36	1.21e-16	81.6	1845	0.169	0.024	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	2.1e-10	51.6	Zinc finger, C2H2 type
2	PF18868 zf-C2H2_3rep	4.4	19.4	Zinc finger C2H2-type, 3 repeats
3	PF13894 zf-C2H2_4	1.3e-06	39.7	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	2.2	19.6	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	0.66	21.6	Zinc-finger double-stranded RNA-binding
6	PF05605 zf-Di19	22	16.8	Drought induced 19 protein (Di19), zinc-binding
7	PF13465 zf-H2C2_2	1.5e-15	68.1	Zinc-finger double domain
8	PF13909 zf-H2C2_5	4.1e+02	12.1	C2H2-type zinc-finger domain
9	PF12874 zf-met	0.96	21.1	Zinc-finger of C2H2 type
10	PF18387 zf_C2H2_ZHX	2.6e+02	12.8	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337862

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316674	0.681	Actin-like protein 9
2	9606.ENSP00000251808	0.650	Grainyhead-like protein 2 homolog
3	9606.ENSP00000288955	0.631	Grainyhead-like protein 3 homolog
4	9606.ENSP00000430432	0.595	Histone deacetylase 2
5	9606.ENSP00000377771	0.583	Signal-induced proliferation-associated protein 1
6	9606.ENSP00000310620	0.563	Sorting nexin-32
7	9606.ENSP00000366998	0.563	Sorting nexin-5
8	9606.ENSP00000405738	0.554	Epithelial splicing regulatory protein 1
9	9606.ENSP00000269394	0.553	Zinc finger protein 750
10	9606.ENSP00000386881	0.552	Dysferlin
11	9606.ENSP00000355988	0.536	Interferon regulatory factor 6
12	9606.ENSP00000324693	0.525	Grainyhead-like protein 1 homolog
13	9606.ENSP00000442068	0.524	Cell division cycle-associated protein 3
14	9606.ENSP00000271971	0.519	Calpain-9
15	9606.ENSP00000332454	0.511	Receptor-interacting serine/threonine-protein kinase 4
16	9606.ENSP00000340330	0.501	Histone acetyltransferase KAT5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0000981	0.898	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.765	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.614	DNA-binding transcription repressor activity
GO:0001227	0.580	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.562	cis-regulatory region sequence-specific DNA binding
GO:0003682	0.405	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0009892	0.971	negative regulation of metabolic process
GO:0006355	0.966	regulation of DNA-templated transcription
GO:0032502	0.943	developmental process
GO:0048523	0.939	negative regulation of cellular process
GO:0042127	0.877	regulation of cell population proliferation
GO:0048856	0.869	anatomical structure development
GO:0048518	0.830	positive regulation of biological process
GO:0048522	0.767	positive regulation of cellular process
GO:2000241	0.741	regulation of reproductive process
GO:0051445	0.727	regulation of meiotic cell cycle
GO:0007049	0.714	cell cycle
GO:0031324	0.706	negative regulation of cellular metabolic process
GO:0010605	0.688	negative regulation of macromolecule metabolic process
GO:0009888	0.669	tissue development
GO:0051172	0.624	negative regulation of nitrogen compound metabolic process
GO:2000242	0.565	negative regulation of reproductive process
GO:0010564	0.559	regulation of cell cycle process
GO:0000003	0.558	reproduction
GO:0045786	0.545	negative regulation of cell cycle
GO:0022414	0.543	reproductive process
GO:0050678	0.496	regulation of epithelial cell proliferation
GO:0010604	0.417	positive regulation of macromolecule metabolic process
GO:0032501	0.406	multicellular organismal process
GO:0009890	0.402	negative regulation of biosynthetic process
GO:0045934	0.392	negative regulation of nucleobase-containing compound metabolic process
GO:0006357	0.392	regulation of transcription by RNA polymerase II
GO:0045892	0.366	negative regulation of DNA-templated transcription
GO:0071840	0.339	cellular component organization or biogenesis
GO:0050896	0.329	response to stimulus
GO:0051173	0.322	positive regulation of nitrogen compound metabolic process
GO:0045935	0.305	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.560	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]