StarFunc result for job id O14756

User Input

>input (317 residues)
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAAC
LTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPIT
LCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSK
YGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQ
QYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTS
LADYILTRSWPKPAQAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14756	1.000	1.000	3.030E-64	317	1.000	1.000	O14756.pdb.gz	H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens OX=9606 GN=HSD17B6 PE=1 SV=1
2	AFDB:Q9R092	0.988	0.988	4.478E-51	317	0.732	0.732	Q9R092.pdb.gz	H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus OX=10090 GN=Hsd17b6 PE=1 SV=1
3	AFDB:O54753	0.991	0.991	7.024E-51	317	0.710	0.710	O54753.pdb.gz	H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus OX=10116 GN=Hsd17b6 PE=1 SV=2
4	AFDB:O75452	0.985	0.985	3.058E-48	317	0.662	0.662	O75452.pdb.gz	RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens OX=9606 GN=RDH16 PE=1 SV=2
5	AFDB:O54909	0.983	0.983	6.721E-48	317	0.647	0.647	O54909.pdb.gz	RDH16_MOUSE Retinol dehydrogenase 16 OS=Mus musculus OX=10090 GN=Rdh16 PE=1 SV=1
6	AFDB:P50170	0.978	0.978	4.815E-47	317	0.644	0.644	P50170.pdb.gz	RDH16_RAT Retinol dehydrogenase 16 OS=Rattus norvegicus OX=10116 GN=Rdh16 PE=1 SV=1
7	AFDB:Q8NEX9	0.969	0.981	2.800E-42	313	0.502	0.508	Q8NEX9.pdb.gz	DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens OX=9606 GN=SDR9C7 PE=1 SV=1
8	AFDB:Q1LXG1	0.969	0.894	4.646E-42	344	0.511	0.471	Q1LXG1.pdb.gz
9	AFDB:Q8VD48	0.971	0.965	4.915E-42	319	0.495	0.492	Q8VD48.pdb.gz	DHRS9_RAT Dehydrogenase/reductase SDR family member 9 OS=Rattus norvegicus OX=10116 GN=Dhrs9 PE=1 SV=1
10	AFDB:F1QJC1	0.972	0.966	3.725E-41	319	0.489	0.486	F1QJC1.pdb.gz
11	PDB:1fdtA	0.751	0.830	7.271E-17	285	0.240	0.267	1fdtA.pdb.gz	The structure of a complex of human 17beta-hydroxysteroid dehydrogenase with estradiol and NADP+ identifies two principal targets for the design of inhibitors.
12	PDB:1nffA	0.647	0.831	5.511E-16	244	0.192	0.250	1nffA.pdb.gz	Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
13	PDB:6emmA	0.658	0.773	9.673E-16	268	0.174	0.205	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
14	PDB:3rkuA	0.532	0.626	1.523E-14	268	0.192	0.228	3rkuA.pdb.gz	Substrate Fingerprint and the Structure of NADP+ Dependent Serine Dehydrogenase from Saccharomyces cerevisiae complexed with NADP+
15	PDB:3ndrA	0.593	0.753	2.674E-14	247	0.158	0.202	3ndrA.pdb.gz	Crystallization and preliminary X-ray analysis of SDR-type pyridoxal dehydrogenase from Mesorhizobium loti
16	PDB:4cqmF	0.654	0.850	3.165E-14	241	0.186	0.245	4cqmF.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
17	PDB:4cqlI	0.623	0.779	3.964E-14	251	0.177	0.223	4cqlI.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
18	PDB:4k26A	0.661	0.784	5.252E-14	265	0.142	0.170	4k26A.pdb.gz	1,1-Dioxo-5,6-dihydro-[4,1,2]oxathiazines, a novel class of 11-HSD1 inhibitors for the treatment of diabetes.
19	PDB:6t7mD	0.551	0.695	7.361E-14	249	0.183	0.233	6t7mD.pdb.gz
20	PDB:4ijuB	0.596	0.664	9.752E-14	282	0.167	0.188	4ijuB.pdb.gz	Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14756	0.0	662	317	1.000	1.000	H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens OX=9606 GN=HSD17B6 PE=1 SV=1
2	Q9R092	7.21e-175	488	317	0.732	0.732	H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus OX=10090 GN=Hsd17b6 PE=1 SV=1
3	O54753	1.87e-170	477	317	0.710	0.710	H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus OX=10116 GN=Hsd17b6 PE=1 SV=2
4	O75452	3.46e-159	449	317	0.662	0.662	RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens OX=9606 GN=RDH16 PE=1 SV=2
5	Q8CGV4	6.43e-155	437	317	0.659	0.659	Q8CGV4_MOUSE Retinol dehydrogenase 1 (All trans) OS=Mus musculus OX=10090 GN=Rdh1 PE=2 SV=1
6	Q8VIJ7	2.23e-153	434	317	0.656	0.656	Q8VIJ7_MOUSE Retinol dehydrogenase type 1 OS=Mus musculus OX=10090 GN=Rdh1 PE=2 SV=1
7	O54909	5.24e-153	433	317	0.647	0.647	RDH16_MOUSE Retinol dehydrogenase 16 OS=Mus musculus OX=10090 GN=Rdh16 PE=1 SV=1
8	Q3V1Y2	1.90e-152	431	317	0.644	0.644	Q3V1Y2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Rdh9 PE=2 SV=1
9	P50170	9.21e-152	430	317	0.659	0.659	RDH16_RAT Retinol dehydrogenase 16 OS=Rattus norvegicus OX=10116 GN=Rdh16 PE=1 SV=1
10	Q8K5C8	1.50e-150	427	317	0.637	0.637	Q8K5C8_MOUSE Cis-retinol/androgen dehydrogenase type 3 OS=Mus musculus OX=10090 GN=Rdh9 PE=2 SV=1
11	Q76LB8	7.67e-148	420	317	0.628	0.628	Q76LB8_MOUSE Cis-retinol/androgen dehydrogenase type 3 OS=Mus musculus OX=10090 GN=Rdh9 PE=2 SV=1
12	Q4V8Y1	2.72e-118	345	328	0.517	0.500	Q4V8Y1_DANRE 11-cis retinol dehydrogenase OS=Danio rerio OX=7955 GN=si:dkey-102c8.5 PE=1 SV=1
13	F1RCW4	3.31e-118	345	328	0.514	0.497	F1RCW4_DANRE 11-cis retinol dehydrogenase isoform X1 OS=Danio rerio OX=7955 GN=im:6901729 PE=1 SV=1
14	Q8NEX9	7.81e-117	341	313	0.514	0.521	DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens OX=9606 GN=SDR9C7 PE=1 SV=1
15	Q6PBR3	8.58e-115	336	319	0.489	0.486	Q6PBR3_DANRE Dehydrogenase/reductase (SDR family) member 9 OS=Danio rerio OX=7955 GN=rdh1l PE=1 SV=1
16	A0A286Y8B5	6.26e-110	324	327	0.483	0.468	A0A286Y8B5_DANRE Retinol dehydrogenase 1 OS=Danio rerio OX=7955 GN=RDHB PE=1 SV=1
17	Q7ZUX4	1.08e-108	321	327	0.476	0.462	Q7ZUX4_DANRE Retinol dehydrogenase 1 OS=Danio rerio OX=7955 GN=RDHB PE=1 SV=1
18	Q8VD48	2.90e-105	312	319	0.467	0.464	DHRS9_RAT Dehydrogenase/reductase SDR family member 9 OS=Rattus norvegicus OX=10116 GN=Dhrs9 PE=1 SV=1
19	Q92781	5.64e-102	303	318	0.502	0.500	RDH5_HUMAN Retinol dehydrogenase 5 OS=Homo sapiens OX=9606 GN=RDH5 PE=1 SV=1
20	Q9BPW9	7.66e-102	303	319	0.438	0.436	DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens OX=9606 GN=DHRS9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	7.3e-36	135.0	short chain dehydrogenase
2	PF13561 adh_short_C2	6.7e-23	93.0	Enoyl-(Acyl carrier protein) reductase
3	PF08659 KR	30	15.9	KR domain
4	PF13460 NAD_binding_10	3.7e+02	12.4	NAD(P)H-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451406

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274192	0.966	3-oxo-5-alpha-steroid 4-dehydrogenase 1
2	9606.ENSP00000358903	0.960	Steroid 17-alpha-hydroxylase/17,20 lyase
3	9606.ENSP00000445122	0.957	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
4	9606.ENSP00000358421	0.956	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
5	9606.ENSP00000477587	0.956	3-oxo-5-alpha-steroid 4-dehydrogenase 2
6	9606.ENSP00000379683	0.953	Aromatase
7	9606.ENSP00000264228	0.944	Polyprenol reductase
8	9606.ENSP00000369927	0.934	Aldo-keto reductase family 1 member C3
9	9606.ENSP00000242375	0.930	3-oxo-5-beta-steroid 4-dehydrogenase
10	9606.ENSP00000224356	0.926	Cytochrome P450 26A1
11	9606.ENSP00000363832	0.925	Aldehyde oxidase
12	9606.ENSP00000295802	0.924	All-trans-retinol 13,14-reductase
13	9606.ENSP00000292427	0.920	Cytochrome P450 11B1, mitochondrial
14	9606.ENSP00000222982	0.917	Cytochrome P450 3A5
15	9606.ENSP00000337224	0.914	Lecithin retinol acyltransferase
16	9606.ENSP00000226444	0.913	Estrogen sulfotransferase
17	9606.ENSP00000258168	0.913	Beta,beta-carotene 15,15'-dioxygenase
18	9606.ENSP00000297785	0.913	Retinal dehydrogenase 1
19	9606.ENSP00000325822	0.913	Cytochrome P450 11B2, mitochondrial
20	9606.ENSP00000478561	0.913	Cytochrome P450 1B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016229	1.000	steroid dehydrogenase activity
GO:0004745	0.997	NAD-retinol dehydrogenase activity
GO:0005515	0.951	protein binding
GO:0033764	0.947	steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0009055	0.384	electron transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010817	0.997	regulation of hormone levels
GO:0006629	0.996	lipid metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0042445	0.987	hormone metabolic process
GO:0044281	0.965	small molecule metabolic process
GO:0008202	0.959	steroid metabolic process
GO:0008209	0.861	androgen metabolic process
GO:0001523	0.685	retinoid metabolic process
GO:0032787	0.440	monocarboxylic acid metabolic process
GO:1901615	0.406	organic hydroxy compound metabolic process
GO:1901576	0.359	organic substance biosynthetic process
GO:0008610	0.344	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.997	endoplasmic reticulum membrane
GO:0031974	0.955	membrane-enclosed lumen
GO:0070013	0.928	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21284	0.997	all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH
EC:1.1.1.105	0.997	all-trans-retinol dehydrogenase (NAD(+)).

[back to server]