StarFunc result for job id O14757

User Input

>input (476 residues)
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14757	1.000	1.000	1.710E-90	476	1.000	1.000	O14757.pdb.gz	CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=2
2	AFDB:Q8AYC9	0.857	0.857	1.544E-78	476	0.842	0.842	Q8AYC9.pdb.gz	CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus OX=9031 GN=CHEK1 PE=1 SV=1
3	AFDB:Q6DE87	0.851	0.855	1.291E-74	474	0.769	0.772	Q6DE87.pdb.gz	CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis OX=8355 GN=chek1 PE=1 SV=2
4	AFDB:E7EPP6	0.616	0.598	4.878E-63	492	0.796	0.770	E7EPP6.pdb.gz	E7EPP6_HUMAN Checkpoint kinase 1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=1
5	AFDB:O61661	0.798	0.743	2.249E-53	512	0.475	0.441	O61661.pdb.gz	CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster OX=7227 GN=grp PE=1 SV=2
6	AFDB:Q7ZVD7	0.474	0.546	8.011E-51	410	0.557	0.646	Q7ZVD7.pdb.gz	Q7ZVD7_DANRE CHK1 checkpoint homolog (S. pombe) OS=Danio rerio OX=7955 GN=id:ibd2720 PE=1 SV=1
7	AFDB:Q9N3Z3	0.659	0.626	1.922E-41	503	0.366	0.346	Q9N3Z3.pdb.gz	CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans OX=6239 GN=chk-1 PE=1 SV=2
8	AFDB:Q5B1T6	0.686	0.615	2.188E-36	534	0.279	0.249	Q5B1T6.pdb.gz	Q5B1T6_EMENI DNA damage checkpoint effector kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05494 PE=4 SV=1
9	AFDB:P34208	0.689	0.662	9.864E-35	496	0.286	0.274	P34208.pdb.gz	CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chk1 PE=1 SV=2
10	AFDB:P38147	0.685	0.621	3.850E-31	527	0.294	0.266	P38147.pdb.gz	CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHK1 PE=1 SV=1
11	PDB:4zhxA	0.498	0.575	6.906E-28	409	0.227	0.264	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
12	PDB:7myjC	0.492	0.503	1.127E-27	465	0.252	0.258	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
13	PDB:6b1uA	0.496	0.533	2.414E-27	442	0.235	0.253	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
14	PDB:4rerA	0.494	0.511	6.427E-27	459	0.248	0.257	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:5ufuA	0.499	0.635	6.315E-26	369	0.227	0.293	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:4rewA	0.482	0.554	3.802E-25	411	0.231	0.268	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5u6yA	0.482	0.498	5.673E-23	459	0.218	0.227	5u6yA.pdb.gz
18	PDB:4cztD	0.438	0.658	2.512E-20	302	0.202	0.318	4cztD.pdb.gz
19	PDB:4d28C	0.443	0.722	4.826E-20	279	0.212	0.362	4d28C.pdb.gz
20	PDB:4c0tA	0.481	0.763	1.687E-19	291	0.172	0.282	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EPP6	0.0	786	492	0.800	0.774	E7EPP6_HUMAN Checkpoint kinase 1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=1
2	O14757	0.0	991	476	1.000	1.000	CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=2
3	O35280	0.0	913	476	0.931	0.931	CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus OX=10090 GN=Chek1 PE=1 SV=2
4	Q6DE87	0.0	766	474	0.773	0.776	CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis OX=8355 GN=chek1 PE=1 SV=2
5	Q7ZVD7	0.0	535	410	0.557	0.646	Q7ZVD7_DANRE CHK1 checkpoint homolog (S. pombe) OS=Danio rerio OX=7955 GN=id:ibd2720 PE=1 SV=1
6	Q8AYC9	0.0	856	476	0.842	0.842	CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus OX=9031 GN=CHEK1 PE=1 SV=1
7	Q91ZN7	0.0	922	476	0.941	0.941	CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus OX=10116 GN=Chek1 PE=2 SV=1
8	O61661	2.62e-149	437	512	0.481	0.447	CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster OX=7227 GN=grp PE=1 SV=2
9	Q9N3Z3	2.85e-95	298	503	0.380	0.360	CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans OX=6239 GN=chk-1 PE=1 SV=2
10	Q84VQ3	2.59e-66	221	439	0.307	0.333	CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CIPK26 PE=1 SV=2
11	Q2V452	7.68e-61	207	441	0.305	0.329	CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana OX=3702 GN=CIPK3 PE=1 SV=2
12	F4IVM7	8.09e-61	207	451	0.305	0.322	F4IVM7_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=CIPK3 PE=1 SV=1
13	Q93VD3	1.11e-57	200	482	0.284	0.280	CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana OX=3702 GN=CIPK23 PE=1 SV=1
14	P34208	2.66e-57	199	496	0.298	0.286	CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chk1 PE=1 SV=2
15	Q9STV4	2.81e-57	197	445	0.229	0.245	CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana OX=3702 GN=CIPK8 PE=1 SV=1
16	Q9MAM1	2.95e-57	197	447	0.292	0.311	CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana OX=3702 GN=CIPK9 PE=1 SV=2
17	Q5B1T6	5.33e-54	191	534	0.317	0.283	Q5B1T6_EMENI DNA damage checkpoint effector kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05494 PE=4 SV=1
18	Q9LDI3	8.47e-54	188	446	0.288	0.307	CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana OX=3702 GN=CIPK24 PE=1 SV=1
19	O22932	1.44e-52	185	435	0.214	0.234	CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CIPK11 PE=1 SV=1
20	Q84XC0	3.12e-52	186	516	0.212	0.196	Q84XC0_PEA non-specific serine/threonine protein kinase OS=Pisum sativum OX=3888 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.6	17.6	ABC1 atypical kinase-like domain
2	PF01636 APH	3.7e+02	12.3	Phosphotransferase enzyme family
3	PF14531 Kinase-like	0.00042	31.3	Kinase-like
4	PF00069 Pkinase	5.6e-63	224.3	Protein kinase domain
5	PF17667 Pkinase_fungal	12	16.1	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	4.7e-32	122.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303706	0.999	M-phase inducer phosphatase 1
2	9606.ENSP00000312995	0.999	Claspin
3	9606.ENSP00000321656	0.999	M-phase inducer phosphatase 3
4	9606.ENSP00000343741	0.999	Serine/threonine-protein kinase ATR
5	9606.ENSP00000372088	0.999	DNA repair protein RAD51 homolog 1
6	9606.ENSP00000269305	0.998	Cellular tumor antigen p53
7	9606.ENSP00000278616	0.998	Serine-protein kinase ATM
8	9606.ENSP00000450607	0.998	Protein timeless homolog
9	9606.ENSP00000262105	0.997	DNA replication licensing factor MCM4
10	9606.ENSP00000371475	0.997	TP53-binding protein 1
11	9606.ENSP00000405726	0.997	Cell division control protein 45 homolog
12	9606.ENSP00000260810	0.996	DNA topoisomerase 2-binding protein 1
13	9606.ENSP00000335153	0.996	Heat shock protein HSP 90-alpha
14	9606.ENSP00000261881	0.995	TIMELESS-interacting protein
15	9606.ENSP00000347232	0.993	Bloom syndrome protein
16	9606.ENSP00000426191	0.993	Cell cycle checkpoint protein RAD17
17	9606.ENSP00000287647	0.992	Fanconi anemia group D2 protein
18	9606.ENSP00000245960	0.991	M-phase inducer phosphatase 2
19	9606.ENSP00000311360	0.991	Cell cycle checkpoint control protein RAD9A
20	9606.ENSP00000376272	0.991	Replication factor C subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0035173	0.993	histone kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0050896	0.986	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0006793	0.983	phosphorus metabolic process
GO:0036211	0.969	protein modification process
GO:0016310	0.966	phosphorylation
GO:0051716	0.964	cellular response to stimulus
GO:0007154	0.954	cell communication
GO:0006468	0.946	protein phosphorylation
GO:0010948	0.940	negative regulation of cell cycle process
GO:1901987	0.936	regulation of cell cycle phase transition
GO:1901988	0.928	negative regulation of cell cycle phase transition
GO:0006950	0.926	response to stress
GO:0042770	0.917	signal transduction in response to DNA damage
GO:0019222	0.783	regulation of metabolic process
GO:0051171	0.718	regulation of nitrogen compound metabolic process
GO:0060255	0.702	regulation of macromolecule metabolic process
GO:0080090	0.693	regulation of primary metabolic process
GO:0031323	0.587	regulation of cellular metabolic process
GO:0048518	0.543	positive regulation of biological process
GO:0007049	0.506	cell cycle
GO:0006139	0.491	nucleobase-containing compound metabolic process
GO:0044260	0.489	cellular macromolecule metabolic process
GO:0090304	0.475	nucleic acid metabolic process
GO:0006259	0.465	DNA metabolic process
GO:0022402	0.463	cell cycle process
GO:0019219	0.452	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.429	positive regulation of cellular process
GO:0007346	0.417	regulation of mitotic cell cycle
GO:0009893	0.353	positive regulation of metabolic process
GO:0006281	0.338	DNA repair
GO:0071840	0.334	cellular component organization or biogenesis
GO:1903047	0.329	mitotic cell cycle process
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005694	0.985	chromosome
GO:0005737	0.959	cytoplasm
GO:0005829	0.922	cytosol
GO:0032991	0.756	protein-containing complex
GO:0098687	0.315	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]