StarFunc result for job id O14763

User Input

>input (440 residues)
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14763	1.000	1.000	6.582E-74	440	1.000	1.000	O14763.pdb.gz	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
2	AFDB:O00220	0.276	0.260	8.024E-36	468	0.516	0.485	O00220.pdb.gz	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
3	AFDB:Q9UBN6	0.254	0.288	1.293E-22	386	0.395	0.451	Q9UBN6.pdb.gz	TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D OS=Homo sapiens OX=9606 GN=TNFRSF10D PE=1 SV=2
4	AFDB:Q9DFV0	0.287	0.288	1.017E-21	438	0.227	0.228	Q9DFV0.pdb.gz
5	AFDB:F1QD95	0.266	0.278	1.617E-19	418	0.216	0.227	F1QD95.pdb.gz	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1
6	AFDB:A0A0G2JZE1	0.254	0.329	2.171E-19	337	0.257	0.335	A0A0G2JZE1.pdb.gz	A0A0G2JZE1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
7	AFDB:O14798	0.237	0.391	6.221E-17	259	0.230	0.390	O14798.pdb.gz	TR10C_HUMAN Tumor necrosis factor receptor superfamily member 10C OS=Homo sapiens OX=9606 GN=TNFRSF10C PE=1 SV=3
8	AFDB:P25118	0.205	0.200	4.596E-15	454	0.195	0.189	P25118.pdb.gz	TNR1A_MOUSE Tumor necrosis factor receptor superfamily member 1A OS=Mus musculus OX=10090 GN=Tnfrsf1a PE=1 SV=1
9	AFDB:Q93038	0.189	0.199	9.847E-14	417	0.200	0.211	Q93038.pdb.gz	TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 OS=Homo sapiens OX=9606 GN=TNFRSF25 PE=1 SV=2
10	AFDB:P25119	0.201	0.187	1.216E-7	474	0.166	0.154	P25119.pdb.gz	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
11	PDB:2gf5A	0.167	0.341	4.550E-2	191	0.048	0.110	2gf5A.pdb.gz
12	PDB:6mksA	0.160	0.604	1.569E-1	90	0.027	0.133	6mksA.pdb.gz
13	PDB:2kr0A	0.099	0.105	1.986E-1	407	0.125	0.135	2kr0A.pdb.gz
14	PDB:5juyB	0.153	0.062	4.532E-1	1234	0.041	0.015	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
15	PDB:2bbzA	0.130	0.259	5.099E-1	190	0.034	0.079	2bbzA.pdb.gz
16	PDB:1dgnA	0.154	0.585	7.262E-1	89	0.036	0.180	1dgnA.pdb.gz
17	PDB:7r5vN	0.127	0.179	7.262E-1	297	0.025	0.037	7r5vN.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
18	PDB:1rjdC	0.070	0.085	9.192E-1	333	0.034	0.045	1rjdC.pdb.gz	Structure of protein phosphatase methyltransferase 1 (PPM1), a leucine carboxyl methyltransferase involved in the regulation of protein phosphatase 2A activity
19	PDB:4ikmA	0.156	0.149	1.234	463	0.032	0.030	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
20	PDB:6ki0A	0.147	0.142	1.234	459	0.041	0.039	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14763	0.0	904	440	1.000	1.000	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
2	Q9UBN6	1.85e-91	283	386	0.409	0.466	TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D OS=Homo sapiens OX=9606 GN=TNFRSF10D PE=1 SV=2
3	O00220	2.97e-64	216	468	0.257	0.241	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
4	A0A0G2JZE1	1.53e-49	173	336	0.284	0.372	A0A0G2JZE1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
5	A0A1W2Q6I0	1.53e-49	173	331	0.282	0.375	A0A1W2Q6I0_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
6	B8YBG7	4.07e-49	172	336	0.280	0.366	B8YBG7_RAT Tumor necrosis factor receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=2 SV=1
7	O14798	1.44e-47	166	259	0.209	0.355	TR10C_HUMAN Tumor necrosis factor receptor superfamily member 10C OS=Homo sapiens OX=9606 GN=TNFRSF10C PE=1 SV=3
8	D3ZYZ1	7.06e-27	110	267	0.127	0.210	D3ZYZ1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=5
9	F1QD95	1.62e-16	83.6	418	0.225	0.237	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1
10	Q9DF34	1.82e-16	82.8	357	0.200	0.246	Q9DF34_DANRE Death receptor OS=Danio rerio OX=7955 GN=zgc:103531 PE=2 SV=1
11	Q0PKX6	3.31e-12	70.1	436	0.136	0.138	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
12	O19131	1.23e-11	68.6	471	0.248	0.231	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
13	P25445	6.40e-08	56.6	335	0.093	0.122	TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
14	K9J972	3.45e-07	52.8	197	0.093	0.208	K9J972_HUMAN FAS receptor variant 9 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
15	P36941	3.37e-06	51.6	435	0.109	0.110	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
16	Q93038	4.90e-06	50.8	417	0.202	0.213	TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 OS=Homo sapiens OX=9606 GN=TNFRSF25 PE=1 SV=2
17	P19438	1.68e-05	49.3	455	0.189	0.182	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
18	Q71F55	1.21e-04	45.8	276	0.107	0.170	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
19	Q80WM9	1.52e-04	45.8	275	0.073	0.116	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
20	F5H6F8	1.77e-04	45.1	217	0.057	0.115	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	6.2e-14	63.3	Death domain
2	PF10099 RskA	26	16.5	Anti-sigma-K factor rskA
3	PF00020 TNFR_c6	4.4e-17	73.6	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241261	0.999	Tumor necrosis factor ligand superfamily member 10
2	9606.ENSP00000301838	0.999	FAS-associated death domain protein
3	9606.ENSP00000351273	0.999	Caspase-8
4	9606.ENSP00000312455	0.996	CASP8 and FADD-like apoptosis regulator
5	9606.ENSP00000286186	0.992	Caspase-10
6	9606.ENSP00000341268	0.990	Tumor necrosis factor receptor type 1-associated DEATH domain protein
7	9606.ENSP00000221132	0.979	Tumor necrosis factor receptor superfamily member 10A
8	9606.ENSP00000311032	0.979	Caspase-3
9	9606.ENSP00000259808	0.977	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000269305	0.974	Cellular tumor antigen p53
11	9606.ENSP00000247668	0.970	TNF receptor-associated factor 2
12	9606.ENSP00000318822	0.963	BH3-interacting domain death agonist
13	9606.ENSP00000216274	0.930	Receptor-interacting serine/threonine-protein kinase 3
14	9606.ENSP00000359424	0.930	Inhibitor of nuclear factor kappa-B kinase subunit alpha
15	9606.ENSP00000430684	0.930	Inhibitor of nuclear factor kappa-B kinase subunit beta
16	9606.ENSP00000483825	0.930	NF-kappa-B essential modulator
17	9606.ENSP00000356694	0.924	Tumor necrosis factor ligand superfamily member 6
18	9606.ENSP00000340409	0.923	Sphingomyelin phosphodiesterase
19	9606.ENSP00000349324	0.917	Tumor necrosis factor receptor superfamily member 10C
20	9606.ENSP00000382423	0.914	Mitogen-activated protein kinase kinase kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005035	1.000	death receptor activity
GO:0036463	0.665	TRAIL receptor activity
GO:0019899	0.380	enzyme binding
GO:0042802	0.365	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0007165	0.993	signal transduction
GO:0023056	0.981	positive regulation of signaling
GO:0010647	0.981	positive regulation of cell communication
GO:0048584	0.979	positive regulation of response to stimulus
GO:0009966	0.976	regulation of signal transduction
GO:1902533	0.960	positive regulation of intracellular signal transduction
GO:0006950	0.949	response to stress
GO:0006915	0.945	apoptotic process
GO:0033554	0.942	cellular response to stress
GO:0097193	0.929	intrinsic apoptotic signaling pathway
GO:0071260	0.895	cellular response to mechanical stimulus
GO:0007166	0.895	cell surface receptor signaling pathway
GO:0043122	0.889	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0034976	0.826	response to endoplasmic reticulum stress
GO:0043123	0.773	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048519	0.478	negative regulation of biological process
GO:0070059	0.459	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0010941	0.455	regulation of cell death
GO:0048523	0.421	negative regulation of cellular process
GO:0043067	0.405	regulation of programmed cell death
GO:0042981	0.368	regulation of apoptotic process
GO:0009607	0.354	response to biotic stimulus
GO:0019222	0.337	regulation of metabolic process
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0006952	0.301	defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0009986	0.955	cell surface
GO:0005829	0.954	cytosol
GO:0043227	0.928	membrane-bounded organelle
GO:0043231	0.835	intracellular membrane-bounded organelle
GO:0012505	0.690	endomembrane system
GO:0032991	0.476	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]