StarFunc result for job id O14776

User Input

>input (1098 residues)
MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
AQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT
TQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPP
VMVPPFRVPLPGMPIPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIA
ASPATLAGATAVSEWTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEP
SEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTG
DERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKW
QFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
ARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERRE
KKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAA
RKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLF
KQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAI
QNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREH
FRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFR
TLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDR
RGPPPPPTASEPTRRSTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7abgA4	0.215	0.520	9.671E-47	405	0.367	0.995	7abgA4.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
2	PDB:7oqeK	0.083	0.186	1.738E-7	406	0.059	0.160	7oqeK.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
3	AFDB:A2A870	0.061	0.058	1.306E-2	1173	0.122	0.114	A2A870.pdb.gz	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
4	AFDB:Q76N89	0.034	0.027	1.698E-2	1606	0.053	0.036	Q76N89.pdb.gz	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
5	AFDB:F1P0K1	0.074	0.080	2.094E-2	997	0.115	0.126	F1P0K1.pdb.gz
6	AFDB:A1Z7Z9	0.067	0.065	2.452E-2	1134	0.112	0.108	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
7	AFDB:Q8N2N9	0.076	0.066	3.732E-2	1353	0.109	0.089	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
8	AFDB:Q62036	0.068	0.070	5.115E-2	1060	0.146	0.151	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
9	AFDB:Q9UPV0	0.053	0.042	7.009E-2	1460	0.135	0.101	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
10	AFDB:Q5HZI1	0.075	0.070	1.316E-1	1210	0.127	0.115	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
11	AFDB:Q07DP5	0.069	0.046	1.541E-1	1715	0.092	0.059	Q07DP5.pdb.gz	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
12	AFDB:Q9BYW2	0.048	0.028	2.004E-1	2564	0.107	0.046	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
13	PDB:7kkfA	0.036	0.220	2.253E-1	162	0.012	0.080	7kkfA.pdb.gz
14	PDB:1yw5A	0.033	0.167	7.156E-1	177	0.011	0.068	1yw5A.pdb.gz
15	PDB:4xb6E	0.032	0.167	9.806E-1	149	0.014	0.101	4xb6E.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
16	PDB:3c98B	0.049	0.151	1.089	230	0.028	0.135	3c98B.pdb.gz
17	PDB:6y0fC	0.024	0.036	1.842	722	0.009	0.014	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
18	PDB:4wjlB	0.037	0.053	2.524	719	0.015	0.022	4wjlB.pdb.gz
19	PDB:7mq8LN	0.027	0.044	2.660	671	0.008	0.013	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6lqsBE	0.031	0.041	2.803	823	0.005	0.006	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14776	0.0	2227	1098	1.000	1.000	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
2	Q8CGF7	0.0	2182	1100	0.978	0.976	TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus OX=10090 GN=Tcerg1 PE=1 SV=2
3	A0A0B4KFB8	2.94e-95	330	1123	0.160	0.157	A0A0B4KFB8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG31367 PE=1 SV=1
4	Q95U01	1.42e-83	279	397	0.122	0.338	Q95U01_DROME GH18144p OS=Drosophila melanogaster OX=7227 GN=CG15187 PE=2 SV=1
5	A0A0B4LGR1	7.01e-83	288	761	0.140	0.202	A0A0B4LGR1_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=CG33097 PE=1 SV=1
6	Q9VI14	1.40e-82	287	763	0.140	0.202	Q9VI14_DROME GH12404p OS=Drosophila melanogaster OX=7227 GN=CG33097 PE=1 SV=2
7	Q6NN86	8.07e-64	231	669	0.118	0.194	Q6NN86_DROME AT20168p OS=Drosophila melanogaster OX=7227 GN=CG31367 PE=1 SV=1
8	Q9LT25	2.73e-53	203	835	0.188	0.247	PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana OX=3702 GN=PRP40C PE=1 SV=1
9	O14176	7.91e-15	81.6	695	0.112	0.177	PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp40 PE=1 SV=1
10	B6EUA9	3.81e-12	73.2	958	0.065	0.074	PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana OX=3702 GN=PRP40A PE=1 SV=1
11	F4JCC1	1.32e-09	65.1	992	0.065	0.072	PR40B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana OX=3702 GN=PRP40B PE=1 SV=1
12	O75400	6.64e-08	59.3	957	0.037	0.043	PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2
13	F5H578	7.97e-08	59.3	972	0.037	0.042	F5H578_HUMAN Pre-mRNA processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=4
14	Q9VQK5	8.91e-08	58.9	806	0.043	0.058	Q9VQK5_DROME LD24714p OS=Drosophila melanogaster OX=7227 GN=Prp40 PE=1 SV=1
15	Q9VN31	1.25e-07	58.2	701	0.029	0.046	Q9VN31_DROME Pre-mRNA 3'-end-processing factor FIP1 OS=Drosophila melanogaster OX=7227 GN=Fip1 PE=1 SV=1
16	H0YG38	1.98e-07	57.0	367	0.046	0.136	H0YG38_HUMAN Pre-mRNA processing factor 40 homolog A (Fragment) OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2
17	Q9R1C7	5.22e-07	56.6	953	0.041	0.047	PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus OX=10090 GN=Prpf40a PE=1 SV=1
18	P34600	4.70e-05	50.1	724	0.035	0.052	YO61_CAEEL WW domain-containing protein ZK1098.1 OS=Caenorhabditis elegans OX=6239 GN=ZK1098.1 PE=1 SV=2
19	Q6NWY9	7.95e-04	46.2	871	0.027	0.034	PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B PE=1 SV=1
20	P33203	0.002	44.7	583	0.048	0.091	PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP40 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01846 FF	1.8e-70	244.3	FF domain
2	PF16512 RhoGAP-FF1	3.2	19.7	p190-A and -B Rho GAPs FF domain
3	PF00397 WW	1.3e-17	74.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296702

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335321	0.987	Splicing factor 3B subunit 1
2	9606.ENSP00000215793	0.985	Splicing factor 3A subunit 1
3	9606.ENSP00000271628	0.984	Splicing factor 3B subunit 4
4	9606.ENSP00000416534	0.981	Probable ATP-dependent RNA helicase DDX46
5	9606.ENSP00000221494	0.979	Splicing factor 3A subunit 2
6	9606.ENSP00000307863	0.978	Splicing factor U2AF 65 kDa subunit
7	9606.ENSP00000362110	0.978	Splicing factor 3A subunit 3
8	9606.ENSP00000254193	0.975	U2 small nuclear ribonucleoprotein A
9	9606.ENSP00000318861	0.975	Splicing factor 3B subunit 2
10	9606.ENSP00000267812	0.968	Microfibrillar-associated protein 1
11	9606.ENSP00000305790	0.967	Splicing factor 3B subunit 3
12	9606.ENSP00000261531	0.957	SNW domain-containing protein 1
13	9606.ENSP00000366557	0.957	Crooked neck-like protein 1
14	9606.ENSP00000360532	0.956	Cell division cycle 5-like protein
15	9606.ENSP00000460348	0.956	Pre-mRNA-processing-splicing factor 8
16	9606.ENSP00000392094	0.955	116 kDa U5 small nuclear ribonucleoprotein component
17	9606.ENSP00000300413	0.954	Small nuclear ribonucleoprotein Sm D1
18	9606.ENSP00000263694	0.953	U5 small nuclear ribonucleoprotein 40 kDa protein
19	9606.ENSP00000215829	0.952	Small nuclear ribonucleoprotein Sm D3
20	9606.ENSP00000317123	0.951	U5 small nuclear ribonucleoprotein 200 kDa helicase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003712	1.000	transcription coregulator activity
GO:0003723	0.999	RNA binding
GO:0070063	0.998	RNA polymerase binding
GO:0140297	0.995	DNA-binding transcription factor binding
GO:0003713	0.992	transcription coactivator activity
GO:0042802	0.967	identical protein binding
GO:0003714	0.955	transcription corepressor activity
GO:0044390	0.952	ubiquitin-like protein conjugating enzyme binding
GO:0061629	0.950	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0070064	0.844	proline-rich region binding
GO:0003711	0.745	transcription elongation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0010467	0.988	gene expression
GO:0016070	0.988	RNA metabolic process
GO:0032784	0.979	regulation of DNA-templated transcription elongation
GO:0048523	0.977	negative regulation of cellular process
GO:0006396	0.977	RNA processing
GO:0016071	0.969	mRNA metabolic process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0008380	0.968	RNA splicing
GO:0010605	0.966	negative regulation of macromolecule metabolic process
GO:0031324	0.966	negative regulation of cellular metabolic process
GO:0006357	0.966	regulation of transcription by RNA polymerase II
GO:0051173	0.964	positive regulation of nitrogen compound metabolic process
GO:0006397	0.961	mRNA processing
GO:0031325	0.955	positive regulation of cellular metabolic process
GO:0034243	0.946	regulation of transcription elongation by RNA polymerase II
GO:1903507	0.935	negative regulation of nucleic acid-templated transcription
GO:0045892	0.932	negative regulation of DNA-templated transcription
GO:0051254	0.925	positive regulation of RNA metabolic process
GO:0045893	0.901	positive regulation of DNA-templated transcription
GO:0045944	0.840	positive regulation of transcription by RNA polymerase II
GO:0032786	0.827	positive regulation of DNA-templated transcription, elongation
GO:0032968	0.816	positive regulation of transcription elongation by RNA polymerase II
GO:0000398	0.431	mRNA splicing, via spliceosome
GO:0000122	0.337	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.996	nuclear speck
GO:0032991	0.717	protein-containing complex
GO:0140513	0.437	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]