StarFunc result for job id O14782

User Input

>input (793 residues)
MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTF
DAVYDASSKQADLYDETVRPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVI
PNAFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKEPGKRLELKENPETGVYIKDL
SSFVTKNVKEIEHVMNLGNQTRAVGSTHMNEVSSRSHAIFIITVECSERGSDGQDHIRVG
KLNLVDLAGSERQNKAGPNTAGGAATPSSGGGGGGGGSGGGAGGERPKEASKINLSLSAL
GNVIAALAGNRSTHIPYRDSKLTRLLQDSLGGNAKTIMVATLGPASHSYDESLSTLRFAN
RAKNIKNKPQVNEDPKDTLLREFQEEIARLKAQLEKRGMLGKRPRRKSSRRKKAVSAPPG
YPEGPVIEAWVAEEEDDNNNNHRPPQPILESALEKNMENYLQEQKERLEEEKAAIQDDRS
LVSEEKQKLLEEKEKMLEDLRREQQATELLAAKYKAMESKLLIGGRNIMDHTNEQQKMLE
LKRQEIAEQKRREREMQQEMMLRDEETMELRGTYTSLQQEVEVKTKKLKKLYAKLQAVKA
EIQDQHDEYIRVRQDLEEAQNEQTRELKLKYLIIENFIPPEEKNKIMNRLFLDCEEEQWK
FQPLVPAGVSSSQMKKRPTSAVGYKRPISQYARVAMAMGSHPRYRAENIMFLELDVSPPA
VFEMEFSHDQEQDPRALHMERLMRLDSFLERPSTSKVRKSRSWCQSPQRPPPSTTHASLA
SASLRPATVADHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35066	0.568	0.566	0.000	796	0.952	0.948	O35066.pdb.gz	KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus OX=10090 GN=Kif3c PE=1 SV=3
2	AFDB:D3ZI07	0.590	0.625	2.756E-90	747	0.613	0.651	D3ZI07.pdb.gz	D3ZI07_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3b PE=3 SV=1
3	AFDB:F1QN54	0.578	0.590	9.117E-86	775	0.603	0.617	F1QN54.pdb.gz	KIF3B_DANRE Kinesin-like protein KIF3B OS=Danio rerio OX=7955 GN=kif3b PE=2 SV=1
4	AFDB:P46871	0.552	0.588	9.266E-85	742	0.538	0.575	P46871.pdb.gz	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
5	AFDB:Q19633	0.570	0.578	2.034E-67	782	0.435	0.441	Q19633.pdb.gz	Q19633_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-11 PE=1 SV=2
6	AFDB:F1LQZ3	0.543	0.610	5.958E-67	702	0.385	0.434	F1LQZ3.pdb.gz	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3
7	AFDB:P46869	0.546	0.551	2.789E-65	786	0.396	0.399	P46869.pdb.gz	FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii OX=3055 GN=FLA10 PE=1 SV=1
8	AFDB:P46872	0.550	0.621	2.789E-65	699	0.382	0.433	P46872.pdb.gz	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1
9	AFDB:A0A2R8QGI2	0.526	0.592	5.195E-65	702	0.406	0.459	A0A2R8QGI2.pdb.gz
10	AFDB:P46867	0.433	0.438	2.834E-64	784	0.402	0.407	P46867.pdb.gz	KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster OX=7227 GN=Klp68D PE=2 SV=2
11	PDB:7wrgA	0.397	0.387	8.579E-35	812	0.173	0.169	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.387	0.392	1.176E-32	783	0.168	0.170	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.344	0.404	8.730E-27	670	0.140	0.166	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:5j6hA	0.061	0.134	1.813E-2	275	0.016	0.047	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:6d7gA	0.053	0.093	8.348E-2	386	0.016	0.034	6d7gA.pdb.gz
16	PDB:2jmuA	0.068	0.183	1.555E-1	224	0.016	0.058	2jmuA.pdb.gz
17	PDB:5kynA	0.075	0.080	1.555E-1	730	0.054	0.059	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
18	PDB:3nwmA	0.054	0.086	2.063E-1	384	0.014	0.029	3nwmA.pdb.gz
19	PDB:7emfT	0.062	0.155	2.063E-1	193	0.009	0.036	7emfT.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:7f5yB	0.042	0.121	2.587E-1	120	0.023	0.150	7f5yB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUD6	0.0	564	701	0.378	0.428	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
2	A0A8I6AL48	0.0	564	684	0.377	0.437	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
3	A0A8I6AP89	0.0	563	686	0.377	0.436	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
4	A0A8I6GCQ1	0.0	562	674	0.376	0.442	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
5	D3ZI07	0.0	909	747	0.594	0.631	D3ZI07_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3b PE=3 SV=1
6	F1LQZ3	0.0	561	726	0.381	0.416	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3
7	O14782	0.0	1636	793	0.999	0.999	KIF3C_HUMAN Kinesin-like protein KIF3C OS=Homo sapiens OX=9606 GN=KIF3C PE=1 SV=4
8	O15066	0.0	900	747	0.588	0.624	KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1
9	O35066	0.0	1480	796	0.951	0.947	KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus OX=10090 GN=Kif3c PE=1 SV=3
10	O55165	0.0	1466	796	0.957	0.954	KIF3C_RAT Kinesin-like protein KIF3C OS=Rattus norvegicus OX=10116 GN=Kif3c PE=2 SV=1
11	P28741	0.0	542	701	0.380	0.429	KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2
12	P46869	0.0	546	786	0.388	0.392	FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii OX=3055 GN=FLA10 PE=1 SV=1
13	P46871	0.0	796	742	0.532	0.569	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
14	P46872	0.0	551	699	0.369	0.419	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1
15	Q19633	0.0	572	782	0.414	0.419	Q19633_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-11 PE=1 SV=2
16	Q61771	0.0	605	747	0.362	0.384	KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus OX=10090 GN=Kif3b PE=1 SV=1
17	P46867	8.09e-172	516	784	0.392	0.397	KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster OX=7227 GN=Klp68D PE=2 SV=2
18	Q9Y496	6.46e-158	478	699	0.284	0.322	KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4
19	Q9VRK9	2.01e-146	447	677	0.274	0.321	Q9VRK9_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=Klp64D PE=3 SV=1
20	Q965T6	9.77e-146	444	646	0.335	0.412	KLP20_CAEEL Kinesin-like protein klp-20 OS=Caenorhabditis elegans OX=6239 GN=klp-20 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06818 Fez1	1.5	20.7	Fez1
2	PF00225 Kinesin	1.1e-109	378.0	Kinesin motor domain
3	PF16183 Kinesin_assoc	35	16.0	Kinesin-associated
4	PF16796 Microtub_bd	6.1e-22	89.7	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264712

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354560	0.998	Kinesin-associated protein 3
2	9606.ENSP00000385808	0.944	Kinesin-like protein KIF3A
3	9606.ENSP00000264538	0.893	Intraflagellar transport protein 57 homolog
4	9606.ENSP00000464443	0.881	Intraflagellar transport protein 20 homolog
5	9606.ENSP00000362121	0.862	Intraflagellar transport protein 52 homolog
6	9606.ENSP00000323580	0.828	Intraflagellar transport protein 88 homolog
7	9606.ENSP00000381167	0.789	Cytoplasmic dynein 2 heavy chain 1
8	9606.ENSP00000474032	0.787	Cytoplasmic dynein 2 light intermediate chain 1
9	9606.ENSP00000406012	0.783	Intraflagellar transport protein 140 homolog
10	9606.ENSP00000367766	0.780	X-linked retinitis pigmentosa GTPase regulator
11	9606.ENSP00000477310	0.775	Dynein light chain 2, cytoplasmic
12	9606.ENSP00000260570	0.773	Intraflagellar transport protein 172 homolog
13	9606.ENSP00000312778	0.772	Intraflagellar transport protein 80 homolog
14	9606.ENSP00000414982	0.763	Kinesin light chain 1
15	9606.ENSP00000296266	0.761	Intraflagellar transport protein 122 homolog
16	9606.ENSP00000264020	0.760	Intraflagellar transport proteins
17	9606.ENSP00000386181	0.754	Tetratricopeptide repeat protein 30B
18	9606.ENSP00000404122	0.751	Intraflagellar transport protein 74 homolog
19	9606.ENSP00000242591	0.740	Intraflagellar transport protein 81 homolog
20	9606.ENSP00000399403	0.732	Kinesin light chain 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003774	0.998	cytoskeletal motor activity
GO:0003777	0.975	microtubule motor activity
GO:0008092	0.920	cytoskeletal protein binding
GO:0015631	0.843	tubulin binding
GO:0019894	0.619	kinesin binding
GO:0008017	0.572	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.967	cellular process
GO:0048518	0.924	positive regulation of biological process
GO:0048522	0.894	positive regulation of cellular process
GO:0031344	0.854	regulation of cell projection organization
GO:0120035	0.811	regulation of plasma membrane bounded cell projection organization
GO:0031346	0.784	positive regulation of cell projection organization
GO:0071840	0.737	cellular component organization or biogenesis
GO:0010975	0.733	regulation of neuron projection development
GO:0016043	0.724	cellular component organization
GO:0007017	0.621	microtubule-based process
GO:0010976	0.580	positive regulation of neuron projection development
GO:0006996	0.417	organelle organization
GO:0051179	0.393	localization
GO:0051234	0.367	establishment of localization
GO:0051641	0.363	cellular localization
GO:0006810	0.321	transport
GO:0051649	0.309	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005856	1.000	cytoskeleton
GO:0005829	0.998	cytosol
GO:0032991	0.995	protein-containing complex
GO:0015630	0.993	microtubule cytoskeleton
GO:0120025	0.987	plasma membrane bounded cell projection
GO:0005929	0.912	cilium
GO:0097542	0.834	ciliary tip
GO:0043231	0.599	intracellular membrane-bounded organelle
GO:0005871	0.417	kinesin complex
GO:0043005	0.379	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]