StarFunc result for job id O14786

User Input

>input (923 residues)
MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
INEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
FELVDGVKLKKDKLNTQSTYSEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14786	1.000	1.000	0.000	923	1.000	1.000	O14786.pdb.gz	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
2	AFDB:P79795	0.598	0.604	0.000	914	0.800	0.807	P79795.pdb.gz	NRP1_CHICK Neuropilin-1 OS=Gallus gallus OX=9031 GN=NRP1 PE=2 SV=1
3	AFDB:Q8QFX6	0.609	0.609	0.000	923	0.648	0.648	Q8QFX6.pdb.gz	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
4	AFDB:A3KNA2	0.653	0.631	3.483E-104	959	0.522	0.503	A3KNA2.pdb.gz
5	AFDB:B3DFP6	0.588	0.586	2.959E-95	927	0.443	0.441	B3DFP6.pdb.gz
6	AFDB:O35375	0.541	0.537	6.391E-93	931	0.446	0.443	O35375.pdb.gz	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
7	AFDB:Q6T491	0.594	0.595	2.889E-92	921	0.446	0.447	Q6T491.pdb.gz
8	AFDB:Q8K2T3	0.171	0.329	1.278E-33	461	0.200	0.401	Q8K2T3.pdb.gz	Q8K2T3_MOUSE Nrp2 protein (Fragment) OS=Mus musculus OX=10090 GN=Nrp2 PE=2 SV=1
9	AFDB:O57460	0.139	0.128	1.392E-28	1022	0.154	0.139	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
10	AFDB:P98063	0.140	0.132	1.762E-28	991	0.157	0.146	P98063.pdb.gz	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
11	PDB:4bxsV	0.193	0.146	1.338E-25	1262	0.133	0.097	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	PDB:7kveB	0.185	0.132	2.671E-21	1374	0.124	0.083	7kveB.pdb.gz
13	PDB:3jd6O	0.150	0.775	3.073E-9	167	0.050	0.275	3jd6O.pdb.gz
14	PDB:2vmeA	0.144	0.490	5.672E-9	256	0.052	0.188	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
15	PDB:2w94A	0.146	0.507	5.453E-8	254	0.049	0.177	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
16	PDB:1o59A	0.128	0.318	7.951E-8	318	0.055	0.160	1o59A.pdb.gz
17	PDB:7b01A	0.104	0.157	1.858E-7	588	0.048	0.075	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
18	PDB:6vlsD	0.105	0.101	6.086E-6	963	0.061	0.058	6vlsD.pdb.gz
19	PDB:7ufgA	0.099	0.082	1.304E-4	1151	0.061	0.049	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
20	PDB:7ufgB	0.086	0.070	1.651E-4	1182	0.031	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14786	0.0	1927	923	1.000	1.000	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
2	O35276	0.0	801	925	0.463	0.462	NRP2_RAT Neuropilin-2 OS=Rattus norvegicus OX=10116 GN=Nrp2 PE=2 SV=1
3	O35375	0.0	806	931	0.464	0.460	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
4	O60462	0.0	805	931	0.463	0.459	NRP2_HUMAN Neuropilin-2 OS=Homo sapiens OX=9606 GN=NRP2 PE=1 SV=3
5	P79795	0.0	1575	914	0.811	0.819	NRP1_CHICK Neuropilin-1 OS=Gallus gallus OX=9031 GN=NRP1 PE=2 SV=1
6	P97333	0.0	1785	923	0.932	0.932	NRP1_MOUSE Neuropilin-1 OS=Mus musculus OX=10090 GN=Nrp1 PE=1 SV=2
7	Q6T867	0.0	805	920	0.456	0.458	Q6T867_DANRE Neuropilin OS=Danio rerio OX=7955 GN=sb:cb513 PE=2 SV=1
8	Q6T868	0.0	791	927	0.457	0.455	Q6T868_DANRE Neuropilin OS=Danio rerio OX=7955 GN=npn-2A PE=2 SV=1
9	Q6T870	0.0	969	959	0.541	0.520	Q6T870_DANRE Neuropilin OS=Danio rerio OX=7955 GN=nrp1b PE=2 SV=1
10	Q8QFX6	0.0	1205	923	0.652	0.652	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
11	Q9QWJ9	0.0	1777	922	0.932	0.933	NRP1_RAT Neuropilin-1 OS=Rattus norvegicus OX=10116 GN=Nrp1 PE=1 SV=1
12	Q8K2T3	5.94e-92	301	461	0.206	0.412	Q8K2T3_MOUSE Nrp2 protein (Fragment) OS=Mus musculus OX=10090 GN=Nrp2 PE=2 SV=1
13	Q08431	3.65e-45	169	387	0.133	0.318	MFGM_HUMAN Lactadherin OS=Homo sapiens OX=9606 GN=MFGE8 PE=1 SV=3
14	Q6RUW2	6.27e-45	171	481	0.128	0.245	Q6RUW2_XENLA DEL-1 OS=Xenopus laevis OX=8355 GN=edil3.L PE=2 SV=1
15	O35474	1.06e-44	171	480	0.129	0.248	EDIL3_MOUSE EGF-like repeat and discoidin I-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Edil3 PE=1 SV=2
16	O43854	6.90e-44	168	480	0.128	0.246	EDIL3_HUMAN EGF-like repeat and discoidin I-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EDIL3 PE=1 SV=1
17	P00451	3.39e-40	164	2351	0.119	0.047	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
18	D3ZEB1	9.42e-38	156	2258	0.117	0.048	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
19	Q7TN96	1.33e-37	155	2258	0.117	0.048	Q7TN96_RAT Factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=2 SV=1
20	P70490	1.60e-36	145	427	0.113	0.244	MFGM_RAT Lactadherin OS=Rattus norvegicus OX=10116 GN=Mfge8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	7.1e-56	198.7	CUB domain
2	PF02408 CUB_2	4.7e+02	12.0	CUB-like domain
3	PF11980 DUF3481	1.8e-43	157.5	C-terminal domain of neuropilin glycoprotein
4	PF00754 F5_F8_type_C	2.9e-51	184.3	F5/8 type C domain
5	PF00629 MAM	7.6e-40	147.8	MAM domain, meprin/A5/mu

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263923	0.999	Vascular endothelial growth factor receptor 2
2	9606.ENSP00000265362	0.999	Semaphorin-3A
3	9606.ENSP00000282397	0.999	Vascular endothelial growth factor receptor 1
4	9606.ENSP00000377061	0.999	Plexin-A1
5	9606.ENSP00000478570	0.999	Vascular endothelial growth factor A
6	9606.ENSP00000002829	0.998	Semaphorin-3F
7	9606.ENSP00000265361	0.998	Semaphorin-3C
8	9606.ENSP00000317128	0.998	Plexin-D1
9	9606.ENSP00000356000	0.998	Plexin-A2
10	9606.ENSP00000484146	0.997	Semaphorin-3B
11	9606.ENSP00000376753	0.996	PDZ domain-containing protein GIPC1
12	9606.ENSP00000352882	0.994	Plexin-A4
13	9606.ENSP00000258526	0.992	Plexin-C1
14	9606.ENSP00000284136	0.990	Semaphorin-3D
15	9606.ENSP00000451040	0.990	Placenta growth factor
16	9606.ENSP00000357268	0.989	Semaphorin-4A
17	9606.ENSP00000303212	0.988	Semaphorin-3E
18	9606.ENSP00000311127	0.984	Vascular endothelial growth factor B
19	9606.ENSP00000261937	0.972	Vascular endothelial growth factor receptor 3
20	9606.ENSP00000359077	0.972	Neural cell adhesion molecule L1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.996	transmembrane receptor protein tyrosine kinase activity
GO:0098772	0.537	molecular function regulator activity
GO:0042802	0.481	identical protein binding
GO:0140677	0.324	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.990	cellular process
GO:0048583	0.988	regulation of response to stimulus
GO:0032501	0.987	multicellular organismal process
GO:0048856	0.986	anatomical structure development
GO:0048519	0.986	negative regulation of biological process
GO:0048522	0.985	positive regulation of cellular process
GO:0048731	0.982	system development
GO:0031344	0.978	regulation of cell projection organization
GO:0040008	0.976	regulation of growth
GO:0050793	0.973	regulation of developmental process
GO:0071840	0.969	cellular component organization or biogenesis
GO:0051239	0.969	regulation of multicellular organismal process
GO:0050920	0.969	regulation of chemotaxis
GO:0048523	0.965	negative regulation of cellular process
GO:0016043	0.962	cellular component organization
GO:0007165	0.962	signal transduction
GO:0022603	0.960	regulation of anatomical structure morphogenesis
GO:0010594	0.959	regulation of endothelial cell migration
GO:0051491	0.958	positive regulation of filopodium assembly
GO:0019222	0.948	regulation of metabolic process
GO:0010595	0.945	positive regulation of endothelial cell migration
GO:0023051	0.943	regulation of signaling
GO:0010646	0.943	regulation of cell communication
GO:0048841	0.939	regulation of axon extension involved in axon guidance
GO:0031345	0.938	negative regulation of cell projection organization
GO:0030154	0.936	cell differentiation
GO:0010975	0.933	regulation of neuron projection development
GO:0007169	0.928	transmembrane receptor protein tyrosine kinase signaling pathway
GO:2000026	0.927	regulation of multicellular organismal development
GO:0009966	0.927	regulation of signal transduction
GO:0040013	0.922	negative regulation of locomotion
GO:0007399	0.922	nervous system development
GO:0032102	0.921	negative regulation of response to external stimulus
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0048468	0.909	cell development
GO:0051241	0.908	negative regulation of multicellular organismal process
GO:0010977	0.907	negative regulation of neuron projection development
GO:0040011	0.905	locomotion
GO:0060284	0.905	regulation of cell development
GO:0050770	0.904	regulation of axonogenesis
GO:0080090	0.901	regulation of primary metabolic process
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0002040	0.893	sprouting angiogenesis
GO:0010721	0.886	negative regulation of cell development
GO:0042221	0.884	response to chemical
GO:0050922	0.884	negative regulation of chemotaxis
GO:0030030	0.881	cell projection organization
GO:0031323	0.879	regulation of cellular metabolic process
GO:0009893	0.877	positive regulation of metabolic process
GO:0050768	0.868	negative regulation of neurogenesis
GO:0050771	0.860	negative regulation of axonogenesis
GO:0048010	0.859	vascular endothelial growth factor receptor signaling pathway
GO:0045926	0.856	negative regulation of growth
GO:0009605	0.855	response to external stimulus
GO:0001667	0.850	ameboidal-type cell migration
GO:0030155	0.846	regulation of cell adhesion
GO:0019220	0.832	regulation of phosphate metabolic process
GO:0051247	0.828	positive regulation of protein metabolic process
GO:0008284	0.818	positive regulation of cell population proliferation
GO:0009888	0.817	tissue development
GO:0006935	0.817	chemotaxis
GO:0120036	0.794	plasma membrane bounded cell projection organization
GO:0001932	0.780	regulation of protein phosphorylation
GO:0048666	0.779	neuron development
GO:0065009	0.769	regulation of molecular function
GO:0048513	0.763	animal organ development
GO:0031175	0.763	neuron projection development
GO:0060322	0.747	head development
GO:0010941	0.739	regulation of cell death
GO:0048584	0.735	positive regulation of response to stimulus
GO:0006950	0.722	response to stress
GO:0008037	0.710	cell recognition
GO:0007417	0.710	central nervous system development
GO:0051240	0.699	positive regulation of multicellular organismal process
GO:1902531	0.696	regulation of intracellular signal transduction
GO:0051094	0.691	positive regulation of developmental process
GO:0001934	0.682	positive regulation of protein phosphorylation
GO:0008038	0.656	neuron recognition
GO:0009719	0.641	response to endogenous stimulus
GO:0007413	0.619	axonal fasciculation
GO:0048812	0.578	neuron projection morphogenesis
GO:0048667	0.559	cell morphogenesis involved in neuron differentiation
GO:0007409	0.540	axonogenesis
GO:0044093	0.518	positive regulation of molecular function
GO:0007411	0.507	axon guidance
GO:0009967	0.470	positive regulation of signal transduction
GO:0008152	0.442	metabolic process
GO:0071704	0.411	organic substance metabolic process
GO:0007155	0.409	cell adhesion
GO:0042981	0.398	regulation of apoptotic process
GO:0009887	0.341	animal organ morphogenesis
GO:0010468	0.323	regulation of gene expression
GO:0001570	0.315	vasculogenesis
GO:0044238	0.314	primary metabolic process
GO:0048762	0.304	mesenchymal cell differentiation
GO:0050790	0.302	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.995	cell junction
GO:0043226	0.926	organelle
GO:0005622	0.921	intracellular anatomical structure
GO:0043227	0.913	membrane-bounded organelle
GO:0005737	0.891	cytoplasm
GO:0031982	0.838	vesicle
GO:0043229	0.813	intracellular organelle
GO:0005925	0.710	focal adhesion
GO:0012505	0.683	endomembrane system
GO:0120025	0.678	plasma membrane bounded cell projection
GO:0005576	0.670	extracellular region
GO:0043231	0.666	intracellular membrane-bounded organelle
GO:0009986	0.574	cell surface
GO:0031410	0.537	cytoplasmic vesicle
GO:0005829	0.477	cytosol
GO:0045202	0.462	synapse
GO:0043233	0.436	organelle lumen
GO:0032991	0.434	protein-containing complex
GO:0030424	0.433	axon
GO:0005615	0.367	extracellular space
GO:0070013	0.362	intracellular organelle lumen
GO:0070062	0.312	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.996	receptor protein-tyrosine kinase.

[back to server]