StarFunc result for job id O14788

User Input

>input (317 residues)
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14788	1.000	1.000	4.907E-56	317	1.000	1.000	O14788.pdb.gz	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
2	AFDB:Q9ESE2	0.515	0.514	1.259E-43	318	0.826	0.824	Q9ESE2.pdb.gz	TNF11_RAT Tumor necrosis factor ligand superfamily member 11 OS=Rattus norvegicus OX=10116 GN=Tnfsf11 PE=2 SV=1
3	AFDB:F1Q767	0.445	0.445	5.965E-21	317	0.233	0.233	F1Q767.pdb.gz
4	AFDB:P50591	0.444	0.485	6.503E-18	281	0.218	0.246	P50591.pdb.gz	TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 OS=Homo sapiens OX=9606 GN=TNFSF10 PE=1 SV=1
5	AFDB:P50592	0.425	0.461	2.031E-17	291	0.227	0.247	P50592.pdb.gz	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
6	AFDB:A0A0U5J7B5	0.447	0.481	2.144E-17	292	0.221	0.240	A0A0U5J7B5.pdb.gz	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
7	AFDB:E7F3U1	0.463	0.576	5.855E-16	251	0.202	0.255	E7F3U1.pdb.gz	E7F3U1_DANRE TNF superfamily member 11 OS=Danio rerio OX=7955 GN=tnfsf11 PE=3 SV=1
8	AFDB:O95150	0.429	0.535	6.889E-16	251	0.199	0.251	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
9	AFDB:Q8K3Y7	0.424	0.524	1.063E-15	252	0.215	0.270	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
10	AFDB:P41047	0.425	0.480	2.672E-15	279	0.174	0.197	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
11	PDB:5h4bA	0.339	0.722	6.519E-6	136	0.041	0.096	5h4bA.pdb.gz
12	PDB:5kc6B	0.318	0.647	1.730E-5	144	0.054	0.118	5kc6B.pdb.gz
13	PDB:7e57B	0.295	0.672	3.695E-5	123	0.076	0.195	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:4fixA	0.200	0.113	2.156E-3	629	0.047	0.024	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:7drtB	0.195	0.137	6.732E-3	496	0.038	0.024	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
16	PDB:3zmoA	0.196	0.328	7.921E-3	172	0.076	0.140	3zmoA.pdb.gz
17	PDB:3i26D	0.138	0.125	1.886E-2	369	0.066	0.057	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
18	PDB:7y1rB	0.203	0.207	2.910E-2	308	0.060	0.062	7y1rB.pdb.gz
19	PDB:5vqfB	0.200	0.199	3.244E-2	320	0.076	0.075	5vqfB.pdb.gz
20	PDB:5jovA	0.162	0.069	3.424E-2	949	0.057	0.019	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14788	0.0	666	317	1.000	1.000	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
2	O35235	0.0	518	316	0.830	0.832	TNF11_MOUSE Tumor necrosis factor ligand superfamily member 11 OS=Mus musculus OX=10090 GN=Tnfsf11 PE=1 SV=2
3	Q9ESE2	0.0	508	318	0.808	0.805	TNF11_RAT Tumor necrosis factor ligand superfamily member 11 OS=Rattus norvegicus OX=10116 GN=Tnfsf11 PE=2 SV=1
4	Q7ZYX9	2.03e-22	97.4	317	0.215	0.215	Q7ZYX9_DANRE TNF superfamily member 10, like OS=Danio rerio OX=7955 GN=wu:fc12f06 PE=2 SV=1
5	P50591	5.90e-21	92.8	281	0.227	0.256	TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 OS=Homo sapiens OX=9606 GN=TNFSF10 PE=1 SV=1
6	P50592	1.60e-19	89.0	291	0.252	0.275	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
7	A0A0U5J7B5	5.07e-16	79.0	292	0.218	0.236	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
8	A0A8I5ZY27	6.62e-16	78.6	289	0.129	0.142	A0A8I5ZY27_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=3 SV=1
9	E7F3U1	6.32e-15	75.5	251	0.151	0.191	E7F3U1_DANRE TNF superfamily member 11 OS=Danio rerio OX=7955 GN=tnfsf11 PE=3 SV=1
10	Q9QYH9	4.54e-08	55.5	239	0.155	0.205	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
11	P41047	6.53e-08	55.1	279	0.132	0.151	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
12	P48023	2.58e-07	53.5	281	0.129	0.146	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
13	Q53ZZ1	2.58e-07	53.5	281	0.129	0.146	Q53ZZ1_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=TNFSF6 PE=2 SV=1
14	Q0VHD7	5.24e-07	52.4	281	0.129	0.146	Q0VHD7_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=2 SV=1
15	P06804	5.30e-07	52.0	235	0.132	0.179	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
16	Q6MG45	1.42e-06	51.2	306	0.104	0.108	Q6MG45_RAT Lymphotoxin-beta OS=Rattus norvegicus OX=10116 GN=Ltb PE=2 SV=1
17	P41155	1.54e-06	51.2	306	0.101	0.105	TNFC_MOUSE Lymphotoxin-beta OS=Mus musculus OX=10090 GN=Ltb PE=2 SV=1
18	P36940	1.76e-06	50.8	278	0.123	0.140	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
19	C1K3N5	2.13e-06	50.1	232	0.126	0.172	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
20	P01375	2.22e-06	50.1	233	0.126	0.172	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19226 DisA	2.3e+02	12.2	DisA glycoprotein
2	PF10931 DUF2735	89	15.2	Protein of unknown function (DUF2735)
3	PF19779 DUF6264	4e+02	12.5	Family of unknown function (DUF6264)
4	PF20326 DUF6621	5.8e+02	11.6	Family of unknown function (DUF6621)
5	PF00229 TNF	3.2e-33	125.8	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381775

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297350	0.999	Tumor necrosis factor receptor superfamily member 11B
2	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
3	9606.ENSP00000465500	0.999	Tumor necrosis factor receptor superfamily member 11A
4	9606.ENSP00000368516	0.985	Leucine-rich repeat-containing G-protein coupled receptor 4
5	9606.ENSP00000286301	0.977	Macrophage colony-stimulating factor 1 receptor
6	9606.ENSP00000306245	0.975	Proto-oncogene c-Fos
7	9606.ENSP00000327513	0.929	Macrophage colony-stimulating factor 1
8	9606.ENSP00000468767	0.916	Tartrate-resistant acid phosphatase type 5
9	9606.ENSP00000271651	0.911	Cathepsin K
10	9606.ENSP00000389377	0.887	Nuclear factor of activated T-cells, cytoplasmic 1
11	9606.ENSP00000162749	0.883	Tumor necrosis factor receptor superfamily member 1A
12	9606.ENSP00000357255	0.881	Osteocalcin
13	9606.ENSP00000282091	0.877	Parathyroid hormone
14	9606.ENSP00000365048	0.866	Tumor necrosis factor ligand superfamily member 13B
15	9606.ENSP00000301691	0.865	Sclerostin
16	9606.ENSP00000263341	0.861	Interleukin-1 beta
17	9606.ENSP00000360493	0.861	Runt-related transcription factor 2
18	9606.ENSP00000247668	0.852	TNF receptor-associated factor 2
19	9606.ENSP00000220772	0.835	Secreted frizzled-related protein 1
20	9606.ENSP00000362680	0.828	Proto-oncogene tyrosine-protein kinase Src

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032813	1.000	tumor necrosis factor receptor superfamily binding
GO:0005125	0.997	cytokine activity
GO:0042802	0.340	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0019222	0.989	regulation of metabolic process
GO:0048522	0.988	positive regulation of cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0051716	0.977	cellular response to stimulus
GO:0048583	0.976	regulation of response to stimulus
GO:0009893	0.975	positive regulation of metabolic process
GO:0010468	0.968	regulation of gene expression
GO:0042221	0.962	response to chemical
GO:1902105	0.960	regulation of leukocyte differentiation
GO:0006355	0.956	regulation of DNA-templated transcription
GO:0010646	0.945	regulation of cell communication
GO:0048856	0.942	anatomical structure development
GO:0023051	0.941	regulation of signaling
GO:0045670	0.936	regulation of osteoclast differentiation
GO:0034103	0.933	regulation of tissue remodeling
GO:0007165	0.932	signal transduction
GO:0048584	0.930	positive regulation of response to stimulus
GO:0010604	0.927	positive regulation of macromolecule metabolic process
GO:0042327	0.925	positive regulation of phosphorylation
GO:0065009	0.924	regulation of molecular function
GO:0009966	0.923	regulation of signal transduction
GO:0045597	0.920	positive regulation of cell differentiation
GO:0002684	0.912	positive regulation of immune system process
GO:0032501	0.908	multicellular organismal process
GO:0023056	0.906	positive regulation of signaling
GO:0010647	0.906	positive regulation of cell communication
GO:0044093	0.905	positive regulation of molecular function
GO:0010033	0.905	response to organic substance
GO:0051240	0.903	positive regulation of multicellular organismal process
GO:0009967	0.902	positive regulation of signal transduction
GO:1902533	0.885	positive regulation of intracellular signal transduction
GO:0043410	0.884	positive regulation of MAPK cascade
GO:0007166	0.883	cell surface receptor signaling pathway
GO:0071310	0.881	cellular response to organic substance
GO:0010720	0.876	positive regulation of cell development
GO:0071345	0.870	cellular response to cytokine stimulus
GO:0031401	0.868	positive regulation of protein modification process
GO:0002376	0.861	immune system process
GO:1902107	0.858	positive regulation of leukocyte differentiation
GO:0033674	0.846	positive regulation of kinase activity
GO:0030154	0.824	cell differentiation
GO:0009605	0.795	response to external stimulus
GO:0030155	0.789	regulation of cell adhesion
GO:0002521	0.780	leukocyte differentiation
GO:0034612	0.777	response to tumor necrosis factor
GO:0002763	0.775	positive regulation of myeloid leukocyte differentiation
GO:0071356	0.732	cellular response to tumor necrosis factor
GO:0002573	0.729	myeloid leukocyte differentiation
GO:0006950	0.680	response to stress
GO:0030316	0.676	osteoclast differentiation
GO:0001932	0.663	regulation of protein phosphorylation
GO:0022407	0.631	regulation of cell-cell adhesion
GO:0048519	0.607	negative regulation of biological process
GO:0019221	0.600	cytokine-mediated signaling pathway
GO:0045124	0.597	regulation of bone resorption
GO:0006357	0.579	regulation of transcription by RNA polymerase II
GO:0051090	0.498	regulation of DNA-binding transcription factor activity
GO:0051091	0.486	positive regulation of DNA-binding transcription factor activity
GO:0048523	0.482	negative regulation of cellular process
GO:0007275	0.418	multicellular organism development
GO:0042127	0.398	regulation of cell population proliferation
GO:0002694	0.392	regulation of leukocyte activation
GO:0045893	0.386	positive regulation of DNA-templated transcription
GO:0045785	0.372	positive regulation of cell adhesion
GO:0033209	0.359	tumor necrosis factor-mediated signaling pathway
GO:0051249	0.354	regulation of lymphocyte activation
GO:0002696	0.346	positive regulation of leukocyte activation
GO:1903037	0.333	regulation of leukocyte cell-cell adhesion
GO:0051251	0.323	positive regulation of lymphocyte activation
GO:0010628	0.313	positive regulation of gene expression
GO:0050863	0.310	regulation of T cell activation
GO:0022409	0.310	positive regulation of cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005576	0.996	extracellular region
GO:0043227	0.639	membrane-bounded organelle
GO:0005622	0.602	intracellular anatomical structure
GO:0005615	0.598	extracellular space
GO:0005737	0.397	cytoplasm
GO:0043231	0.396	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]