StarFunc result for job id O14792

User Input

>input (307 residues)
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIII
GVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKT
PAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVR
DGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQ
INASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
GRTFDWH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14792	1.000	1.000	4.816E-61	307	1.000	1.000	O14792.pdb.gz	HS3S1_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS3ST1 PE=1 SV=1
2	AFDB:O35310	0.908	0.897	7.363E-55	311	0.883	0.871	O35310.pdb.gz	HS3S1_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 1 OS=Mus musculus OX=10090 GN=Hs3st1 PE=1 SV=1
3	PDB:1zrhA	0.855	0.998	4.851E-50	263	0.857	1.000	1zrhA.pdb.gz	Crystal structure of Human heparan sulfate glucosamine 3-O-sulfotransferase 1 in complex with PAP
4	AFDB:A0MGZ3	0.849	0.843	2.891E-42	309	0.570	0.566	A0MGZ3.pdb.gz	A0MGZ3_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st7 PE=2 SV=1
5	AFDB:A0MGZ1	0.835	0.846	1.635E-40	303	0.515	0.521	A0MGZ1.pdb.gz
6	AFDB:Q8IZT8	0.829	0.737	1.173E-36	346	0.466	0.413	Q8IZT8.pdb.gz	HS3S5_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 5 OS=Homo sapiens OX=9606 GN=HS3ST5 PE=1 SV=1
7	PDB:7scdA	0.829	0.688	1.209E-35	371	0.456	0.377	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
8	AFDB:Q9QZS6	0.808	0.638	9.481E-32	390	0.381	0.300	Q9QZS6.pdb.gz	HS3SB_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Mus musculus OX=10090 GN=Hs3st3b1 PE=2 SV=2
9	AFDB:Q9Y662	0.801	0.633	1.194E-31	390	0.381	0.300	Q9Y662.pdb.gz	HS3SB_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Homo sapiens OX=9606 GN=HS3ST3B1 PE=1 SV=1
10	AFDB:Q9Y663	0.806	0.612	1.340E-31	406	0.381	0.288	Q9Y663.pdb.gz	HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Homo sapiens OX=9606 GN=HS3ST3A1 PE=1 SV=1
11	AFDB:Q8BKN6	0.807	0.633	1.687E-31	393	0.381	0.298	Q8BKN6.pdb.gz	HS3SA_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Mus musculus OX=10090 GN=Hs3st3a1 PE=2 SV=1
12	AFDB:Q673U1	0.815	0.683	1.894E-31	367	0.378	0.316	Q673U1.pdb.gz	HS3S2_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Hs3st2 PE=2 SV=2
13	PDB:1j99A	0.331	0.354	6.029E-4	284	0.134	0.144	1j99A.pdb.gz	Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate.
14	PDB:1cjmA	0.333	0.437	7.167E-4	223	0.114	0.157	1cjmA.pdb.gz
15	PDB:7eovA	0.392	0.432	8.520E-4	274	0.134	0.150	7eovA.pdb.gz	The crystal structure of mouse SULT2A8 reveals the mechanism of 7 alpha-hydroxyl, bile acid sulfation.
16	PDB:5mekA	0.446	0.429	1.432E-3	322	0.143	0.137	5mekA.pdb.gz	Structural and biochemical studies of sulphotransferase 18 from Arabidopsis thaliana explain its substrate specificity and reaction mechanism.
17	PDB:2gwhB	0.314	0.331	1.910E-3	288	0.147	0.156	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
18	PDB:1q1qA	0.359	0.391	2.548E-3	278	0.160	0.176	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
19	PDB:3bfxA	0.276	0.322	2.548E-3	253	0.121	0.146	3bfxA.pdb.gz	Crystal Structures of Human Sulfotransferases Sult1B1 and Sult1C1 Complexed with the Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
20	PDB:2iyvA	0.298	0.448	2.699E-3	179	0.072	0.123	2iyvA.pdb.gz	Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14792	0.0	637	307	1.000	1.000	HS3S1_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=HS3ST1 PE=1 SV=1
2	O35310	0.0	539	311	0.847	0.836	HS3S1_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 1 OS=Mus musculus OX=10090 GN=Hs3st1 PE=1 SV=1
3	A0MGZ3	1.57e-127	367	309	0.541	0.537	A0MGZ3_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st7 PE=2 SV=1
4	Q29RB5	3.42e-113	331	303	0.505	0.512	Q29RB5_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=zgc:136835 PE=2 SV=1
5	Q8IZT8	1.44e-102	305	346	0.446	0.396	HS3S5_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 5 OS=Homo sapiens OX=9606 GN=HS3ST5 PE=1 SV=1
6	Q9TZK5	9.20e-76	236	307	0.371	0.371	Q9TZK5_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.1 PE=4 SV=2
7	Q673U1	1.94e-74	234	367	0.368	0.308	HS3S2_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Mus musculus OX=10090 GN=Hs3st2 PE=2 SV=2
8	Q80W66	1.94e-74	234	367	0.368	0.308	HS3S2_RAT Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Rattus norvegicus OX=10116 GN=Hs3st2 PE=1 SV=1
9	A0MGZ2	2.16e-74	233	334	0.388	0.356	A0MGZ2_DANRE Sulfotransferase OS=Danio rerio OX=7955 GN=HS3st6 PE=2 SV=1
10	Q9Y278	3.09e-74	234	367	0.368	0.308	HS3S2_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 2 OS=Homo sapiens OX=9606 GN=HS3ST2 PE=1 SV=1
11	D3YVV6	1.50e-73	234	449	0.388	0.265	D3YVV6_MOUSE Sulfotransferase OS=Mus musculus OX=10090 GN=Hs3st4 PE=3 SV=1
12	Q9QZS6	5.02e-73	231	390	0.371	0.292	HS3SB_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Mus musculus OX=10090 GN=Hs3st3b1 PE=2 SV=2
13	Q5GFD5	5.29e-73	230	342	0.375	0.336	HS3S6_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 6 OS=Mus musculus OX=10090 GN=Hs3st6 PE=2 SV=1
14	Q8BKN6	2.14e-72	230	393	0.371	0.290	HS3SA_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Mus musculus OX=10090 GN=Hs3st3a1 PE=2 SV=1
15	Q9Y663	7.25e-72	229	406	0.365	0.276	HS3SA_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Homo sapiens OX=9606 GN=HS3ST3A1 PE=1 SV=1
16	Q9Y662	1.02e-71	228	390	0.365	0.287	HS3SB_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Homo sapiens OX=9606 GN=HS3ST3B1 PE=1 SV=1
17	Q96QI5	1.77e-71	226	342	0.368	0.330	HS3S6_HUMAN Heparan sulfate glucosamine 3-O-sulfotransferase 6 OS=Homo sapiens OX=9606 GN=HS3ST6 PE=1 SV=2
18	Q9VWJ7	6.11e-71	226	384	0.371	0.297	Q9VWJ7_DROME Heparan sulfate 3-O sulfotransferase-B, isoform A OS=Drosophila melanogaster OX=7227 GN=Hs3st-B PE=2 SV=1
19	Q4TTA0	3.25e-69	218	291	0.362	0.381	Q4TTA0_CAEEL Sulfotransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hst-3.2 PE=4 SV=1
20	Q9EQW8	1.14e-31	126	872	0.290	0.102	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00685 Sulfotransfer_1	6.2e-37	139.1	Sulfotransferase domain
2	PF13469 Sulfotransfer_3	5.3e-13	61.4	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000002596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307046	0.958	Syndecan-2
2	9606.ENSP00000359864	0.954	Glypican-4
3	9606.ENSP00000292377	0.950	Glypican-2
4	9606.ENSP00000264039	0.949	Glypican-1
5	9606.ENSP00000366246	0.949	Glypican-6
6	9606.ENSP00000377836	0.945	Glypican-3
7	9606.ENSP00000366267	0.942	Glypican-5
8	9606.ENSP00000363827	0.941	Basement membrane-specific heparan sulfate proteoglycan core protein
9	9606.ENSP00000368678	0.936	Agrin
10	9606.ENSP00000344468	0.935	Syndecan-3
11	9606.ENSP00000370542	0.932	Syndecan-1
12	9606.ENSP00000361818	0.930	Syndecan-4
13	9606.ENSP00000356671	0.900	Antithrombin-III
14	9606.ENSP00000356433	0.871	Uronyl 2-sulfotransferase
15	9606.ENSP00000359581	0.832	Heparan sulfate 2-O-sulfotransferase 1
16	9606.ENSP00000259241	0.816	Heparan-sulfate 6-O-sulfotransferase 1
17	9606.ENSP00000261858	0.816	D-glucuronyl C5-epimerase
18	9606.ENSP00000359579	0.800	Heparan sulfate 2-O-sulfotransferase 1
19	9606.ENSP00000429473	0.710	Heparan-sulfate 6-O-sulfotransferase 2
20	9606.ENSP00000220562	0.679	Exostosin-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008467	1.000	[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity
GO:0005488	0.708	binding
GO:0005515	0.460	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009101	0.996	glycoprotein biosynthetic process
GO:0006029	0.995	proteoglycan metabolic process
GO:0030166	0.993	proteoglycan biosynthetic process
GO:0044272	0.989	sulfur compound biosynthetic process
GO:0015012	0.958	heparan sulfate proteoglycan biosynthetic process
GO:0030203	0.945	glycosaminoglycan metabolic process
GO:0006023	0.939	aminoglycan biosynthetic process
GO:0006024	0.934	glycosaminoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0070013	0.996	intracellular organelle lumen
GO:0016020	0.931	membrane
GO:0005796	0.787	Golgi lumen
GO:0000139	0.708	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.2.23	1.000	[heparan sulfate]-glucosamine 3-sulfotransferase 1.

[back to server]