StarFunc result for job id O14793

User Input

>input (375 residues)
MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQI
LSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIIT
MPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPM
KDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVT
FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIA
PKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQII
YGKIPAMVVDRCGCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08689	0.925	0.922	1.976E-67	376	0.963	0.960	O08689.pdb.gz	GDF8_MOUSE Growth/differentiation factor 8 OS=Mus musculus OX=10090 GN=Mstn PE=1 SV=1
2	PDB:5ntuA	0.782	0.946	8.690E-52	308	0.805	0.981	5ntuA.pdb.gz
3	AFDB:O42222	0.484	0.485	3.952E-49	374	0.677	0.679	O42222.pdb.gz	GDF8_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=mstnb PE=2 SV=2
4	AFDB:Q8JFP9	0.619	0.600	7.407E-47	390	0.632	0.608	Q8JFP9.pdb.gz	Q8JFP9_DANRE Gdf11-like OS=Danio rerio OX=7955 GN=gdf11 PE=2 SV=2
5	AFDB:A0A024RB20	0.498	0.464	1.951E-45	407	0.616	0.568	A0A024RB20.pdb.gz
6	AFDB:Q5I3Q2	0.451	0.450	8.048E-45	376	0.632	0.630	Q5I3Q2.pdb.gz	GDF8_EPICO Growth/differentiation factor 8 OS=Epinephelus coioides OX=94232 GN=gdf-8 PE=1 SV=1
7	AFDB:B3DIZ5	0.405	0.415	7.945E-44	366	0.589	0.604	B3DIZ5.pdb.gz
8	PDB:5nxsA	0.621	0.778	3.806E-43	290	0.765	0.990	5nxsA.pdb.gz
9	PDB:6umxA	0.552	0.729	1.928E-41	279	0.744	1.000	6umxA.pdb.gz
10	PDB:5nxsB	0.481	0.659	2.875E-34	251	0.659	0.984	5nxsB.pdb.gz
11	AFDB:Q9V4F4	0.605	0.402	2.457E-25	598	0.301	0.189	Q9V4F4.pdb.gz	Q9V4F4_DROME LD29161p OS=Drosophila melanogaster OX=7227 GN=myo PE=2 SV=1
12	AFDB:P27093	0.334	0.323	8.410E-19	391	0.253	0.243	P27093.pdb.gz	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
13	AFDB:Q91350	0.302	0.306	1.232E-18	370	0.253	0.257	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
14	AFDB:Q07257	0.346	0.300	1.618E-18	442	0.245	0.208	Q07257.pdb.gz	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
15	PDB:5hlyA	0.333	0.399	6.151E-17	299	0.232	0.291	5hlyA.pdb.gz
16	PDB:5vqfB	0.257	0.295	9.917E-16	320	0.253	0.297	5vqfB.pdb.gz
17	PDB:3rjrC	0.261	0.282	5.374E-15	343	0.248	0.271	3rjrC.pdb.gz
18	PDB:5ffoG	0.264	0.321	8.205E-14	297	0.229	0.290	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:7y1rB	0.261	0.307	2.441E-13	308	0.229	0.279	7y1rB.pdb.gz
20	PDB:6q2sA	0.151	0.518	1.100E-2	98	0.059	0.224	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D1LWV1	0.0	724	375	0.917	0.917	D1LWV1_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
2	D1LWV2	0.0	722	375	0.917	0.917	D1LWV2_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
3	O08689	0.0	760	376	0.963	0.960	GDF8_MOUSE Growth/differentiation factor 8 OS=Mus musculus OX=10090 GN=Mstn PE=1 SV=1
4	O14793	0.0	783	375	1.000	1.000	GDF8_HUMAN Growth/differentiation factor 8 OS=Homo sapiens OX=9606 GN=MSTN PE=1 SV=1
5	O18836	0.0	743	375	0.941	0.941	GDF8_BOVIN Growth/differentiation factor 8 OS=Bos taurus OX=9913 GN=MSTN PE=1 SV=2
6	O35312	0.0	751	376	0.949	0.947	GDF8_RAT Growth/differentiation factor 8 OS=Rattus norvegicus OX=10116 GN=Mstn PE=2 SV=1
7	O42220	0.0	726	375	0.920	0.920	GDF8_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
8	O42221	0.0	728	375	0.923	0.923	GDF8_MELGA Growth/differentiation factor 8 OS=Meleagris gallopavo OX=9103 GN=MSTN PE=2 SV=2
9	O42222	0.0	531	374	0.677	0.679	GDF8_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=mstnb PE=2 SV=2
10	Q06BS3	0.0	726	375	0.920	0.920	Q06BS3_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=GDF8 PE=2 SV=1
11	Q5I3Q2	0.0	518	376	0.643	0.641	GDF8_EPICO Growth/differentiation factor 8 OS=Epinephelus coioides OX=94232 GN=gdf-8 PE=1 SV=1
12	Q8JFP9	0.0	511	390	0.621	0.597	Q8JFP9_DANRE Gdf11-like OS=Danio rerio OX=7955 GN=gdf11 PE=2 SV=2
13	Q9GM97	0.0	766	375	0.973	0.973	GDF8_HORSE Growth/differentiation factor 8 OS=Equus caballus OX=9796 GN=MSTN PE=2 SV=1
14	H0YI30	5.40e-172	486	380	0.603	0.595	H0YI30_HUMAN Growth differentiation factor 11 (Fragment) OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
15	Q9Z217	5.69e-172	487	405	0.603	0.558	GDF11_RAT Growth/differentiation factor 11 OS=Rattus norvegicus OX=10116 GN=Gdf11 PE=2 SV=2
16	O95390	6.66e-172	487	407	0.603	0.555	GDF11_HUMAN Growth/differentiation factor 11 OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
17	Q9Z1W4	7.56e-172	486	405	0.603	0.558	GDF11_MOUSE Growth/differentiation factor 11 OS=Mus musculus OX=10090 GN=Gdf11 PE=1 SV=1
18	Q68IN2	7.91e-162	459	366	0.587	0.601	Q68IN2_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=gdf8l PE=2 SV=1
19	Q9XZ62	3.61e-38	146	598	0.312	0.196	Q9XZ62_DROME Myoglianin OS=Drosophila melanogaster OX=7227 GN=myo PE=2 SV=1
20	Q9V4F4	1.78e-37	144	598	0.312	0.196	Q9V4F4_DROME LD29161p OS=Drosophila melanogaster OX=7227 GN=myo PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.9e-15	68.8	TGF-beta propeptide
2	PF00019 TGF_beta	7.7e-26	102.3	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260950

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340361	0.999	Activin receptor type-2B
2	9606.ENSP00000256759	0.998	Follistatin
3	9606.ENSP00000166139	0.996	Follistatin-related protein 3
4	9606.ENSP00000241416	0.991	Activin receptor type-2A
5	9606.ENSP00000442656	0.989	Activin receptor type-1B
6	9606.ENSP00000262160	0.979	Mothers against decapentaplegic homolog 2
7	9606.ENSP00000332973	0.976	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000341551	0.976	Mothers against decapentaplegic homolog 4
9	9606.ENSP00000364133	0.976	TGF-beta receptor type-1
10	9606.ENSP00000368880	0.960	Forkhead box protein O1
11	9606.ENSP00000250003	0.866	Myoblast determination protein 1
12	9606.ENSP00000311184	0.865	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2
13	9606.ENSP00000428205	0.862	F-box only protein 32
14	9606.ENSP00000241651	0.860	Myogenin
15	9606.ENSP00000324763	0.844	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1
16	9606.ENSP00000363390	0.837	E3 ubiquitin-protein ligase TRIM63
17	9606.ENSP00000052754	0.829	Decorin
18	9606.ENSP00000385824	0.824	Forkhead box protein O3
19	9606.ENSP00000363827	0.816	Basement membrane-specific heparan sulfate proteoglycan core protein
20	9606.ENSP00000302665	0.801	Insulin-like growth factor I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0008083	0.999	growth factor activity
GO:0097367	0.575	carbohydrate derivative binding
GO:1901681	0.571	sulfur compound binding
GO:0005539	0.570	glycosaminoglycan binding
GO:0008201	0.552	heparin binding
GO:0046983	0.533	protein dimerization activity
GO:0042803	0.473	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.983	cellular process
GO:0048856	0.976	anatomical structure development
GO:0050794	0.974	regulation of cellular process
GO:0048519	0.928	negative regulation of biological process
GO:0048523	0.826	negative regulation of cellular process
GO:0048518	0.807	positive regulation of biological process
GO:0019222	0.794	regulation of metabolic process
GO:0061061	0.775	muscle structure development
GO:0048513	0.757	animal organ development
GO:0060255	0.742	regulation of macromolecule metabolic process
GO:0048522	0.723	positive regulation of cellular process
GO:0050896	0.714	response to stimulus
GO:0031323	0.653	regulation of cellular metabolic process
GO:0050793	0.650	regulation of developmental process
GO:0008283	0.641	cell population proliferation
GO:0007517	0.611	muscle organ development
GO:0048583	0.602	regulation of response to stimulus
GO:0033002	0.573	muscle cell proliferation
GO:0023051	0.572	regulation of signaling
GO:0032501	0.571	multicellular organismal process
GO:0010646	0.563	regulation of cell communication
GO:0009966	0.536	regulation of signal transduction
GO:0080090	0.507	regulation of primary metabolic process
GO:0051171	0.505	regulation of nitrogen compound metabolic process
GO:0010468	0.487	regulation of gene expression
GO:0051716	0.484	cellular response to stimulus
GO:0042127	0.434	regulation of cell population proliferation
GO:0009893	0.434	positive regulation of metabolic process
GO:0051239	0.429	regulation of multicellular organismal process
GO:0007275	0.385	multicellular organism development
GO:0010604	0.368	positive regulation of macromolecule metabolic process
GO:0019219	0.367	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.356	regulation of RNA metabolic process
GO:0045595	0.348	regulation of cell differentiation
GO:0009889	0.337	regulation of biosynthetic process
GO:0051173	0.325	positive regulation of nitrogen compound metabolic process
GO:0031325	0.325	positive regulation of cellular metabolic process
GO:0010556	0.324	regulation of macromolecule biosynthetic process
GO:0031326	0.322	regulation of cellular biosynthetic process
GO:1903506	0.305	regulation of nucleic acid-templated transcription
GO:0009888	0.302	tissue development
GO:0006355	0.301	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.860	intracellular anatomical structure
GO:0005737	0.810	cytoplasm
GO:0070013	0.345	intracellular organelle lumen
GO:0043227	0.305	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]