StarFunc result for job id O14795

User Input

>input (1591 residues)
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHRETDSIHSCHSSH
SLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVLQKDHFLGPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27715	0.668	0.498	0.000	2155	0.538	0.397	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
2	AFDB:Q62768	0.723	0.665	0.000	1735	0.783	0.718	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
3	AFDB:Q62769	0.747	0.733	0.000	1622	0.943	0.925	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
4	AFDB:Q8NB66	0.713	0.515	0.000	2214	0.596	0.428	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
5	AFDB:Q9UPW8	0.735	0.688	0.000	1703	0.785	0.733	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
6	AFDB:Q9Z1N9	0.820	0.815	0.000	1602	0.955	0.949	Q9Z1N9.pdb.gz	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
7	PDB:1cjyA	0.070	0.167	3.063E-7	633	0.035	0.087	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
8	AFDB:Q9JIS1	0.060	0.061	5.425E-6	1555	0.074	0.075	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
9	PDB:5a50A	0.067	0.544	7.565E-6	165	0.019	0.188	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
10	PDB:3pfqA	0.051	0.152	8.899E-6	523	0.050	0.153	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
11	AFDB:Q9JIR4	0.054	0.053	1.222E-5	1615	0.079	0.078	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
12	PDB:5a52A	0.064	0.572	1.282E-5	154	0.019	0.201	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
13	PDB:5izrC	0.068	0.160	1.282E-5	659	0.018	0.042	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5ixcA	0.070	0.157	1.335E-5	684	0.018	0.041	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:3nsjA	0.070	0.201	1.391E-5	530	0.021	0.064	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
16	AFDB:X2JC00	0.063	0.071	1.761E-5	1404	0.086	0.098	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
17	PDB:7cunG	0.067	0.096	1.848E-5	895	0.063	0.113	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
18	AFDB:D3ZD48	0.071	0.205	1.910E-5	512	0.041	0.129	D3ZD48.pdb.gz	D3ZD48_RAT RAB11 family interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Rab11fip2 PE=4 SV=3
19	PDB:5iz5B	0.071	0.148	2.264E-5	746	0.018	0.039	5iz5B.pdb.gz
20	PDB:5iz5A	0.069	0.140	2.557E-5	757	0.016	0.034	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	G5EDN9	1513	1819	0.461	0.404	G5EDN9_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=1
2	H9XVP2	1784	3186	0.532	0.266	H9XVP2_DROME Unc-13, isoform E OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
3	L0MPR2	1400	2711	0.417	0.245	L0MPR2_DROME Unc-13, isoform F OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
4	O14795	3332	1591	1.000	1.000	UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2
5	O96959	1739	1304	0.527	0.643	O96959_DROME UNC-13 protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
6	O96960	1740	1724	0.521	0.481	O96960_DROME UNC-13-B protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
7	P27715	1516	2155	0.461	0.341	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
8	Q4KUS2	2136	1712	0.642	0.597	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
9	Q62768	2116	1735	0.642	0.588	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
10	Q62769	3106	1622	0.944	0.926	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
11	Q62770	1907	2204	0.559	0.403	UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus OX=10116 GN=Unc13c PE=1 SV=3
12	Q8IM86	1786	3183	0.531	0.265	Q8IM86_DROME Unc-13, isoform B OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
13	Q8IM87	1771	2871	0.530	0.294	Q8IM87_DROME Unc-13, isoform A OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=1
14	Q8K0T7	1924	2210	0.559	0.402	UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus OX=10090 GN=Unc13c PE=1 SV=3
15	Q8NB66	1917	2214	0.558	0.401	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
16	Q8T049	1757	1508	0.530	0.560	Q8T049_DROME LD28927p OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
17	Q9U4K9	1709	1752	0.524	0.476	Q9U4K9_DROME UNC-13 OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
18	Q9UPW8	2134	1703	0.649	0.607	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	Q9V483	1786	2874	0.538	0.298	Q9V483_DROME Unc-13, isoform C OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=4 SV=4
20	Q9Z1N9	3166	1602	0.956	0.949	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	7.1e-08	43.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00168 C2	8.1e-50	178.8	C2 domain
3	PF06292 MUN	5.7e-155	528.0	MUN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367756

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428417	0.999	Regulating synaptic membrane exocytosis protein 1
2	9606.ENSP00000222812	0.989	Syntaxin-1A
3	9606.ENSP00000314214	0.985	Vesicle-associated membrane protein 2
4	9606.ENSP00000254976	0.984	Synaptosomal-associated protein 25
5	9606.ENSP00000362399	0.984	Syntaxin-binding protein 1
6	9606.ENSP00000261205	0.961	Synaptotagmin-1
7	9606.ENSP00000296452	0.953	Protein bassoon
8	9606.ENSP00000345824	0.949	Benzodiazepine receptor (peripheral) associated protein 1
9	9606.ENSP00000468263	0.930	ELKS/Rab6-interacting/CAST family member 1
10	9606.ENSP00000278193	0.926	Protein lin-7 homolog C
11	9606.ENSP00000265381	0.925	Amyloid-beta A4 precursor protein-binding family A member 1
12	9606.ENSP00000367408	0.925	Peripheral plasma membrane protein CASK
13	9606.ENSP00000351832	0.912	Rab3 GTPase-activating protein non-catalytic subunit
14	9606.ENSP00000222256	0.909	Ras-related protein Rab-3A
15	9606.ENSP00000447488	0.908	Protein lin-7 homolog A
16	9606.ENSP00000221459	0.904	Protein lin-7 homolog B
17	9606.ENSP00000253925	0.903	Liprin-alpha-1
18	9606.ENSP00000335614	0.902	Liprin-alpha-3
19	9606.ENSP00000305613	0.890	Complexin-1
20	9606.ENSP00000482950	0.889	Double C2-like domain-containing protein beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000149	1.000	SNARE binding
GO:0005516	0.998	calmodulin binding
GO:0030742	0.990	GTP-dependent protein binding
GO:0060089	0.875	molecular transducer activity
GO:0017075	0.866	syntaxin-1 binding
GO:0038023	0.576	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0045055	0.984	regulated exocytosis
GO:0006836	0.959	neurotransmitter transport
GO:0099643	0.955	signal release from synapse
GO:0007269	0.954	neurotransmitter secretion
GO:0099504	0.949	synaptic vesicle cycle
GO:0017156	0.948	calcium-ion regulated exocytosis
GO:0016079	0.938	synaptic vesicle exocytosis
GO:0140029	0.933	exocytic process
GO:0051046	0.867	regulation of secretion
GO:0048522	0.861	positive regulation of cellular process
GO:0099177	0.827	regulation of trans-synaptic signaling
GO:1903530	0.822	regulation of secretion by cell
GO:0050896	0.799	response to stimulus
GO:0071840	0.739	cellular component organization or biogenesis
GO:0017157	0.734	regulation of exocytosis
GO:0016043	0.725	cellular component organization
GO:1903532	0.690	positive regulation of secretion by cell
GO:0050804	0.665	modulation of chemical synaptic transmission
GO:0050806	0.649	positive regulation of synaptic transmission
GO:0051716	0.606	cellular response to stimulus
GO:0051128	0.602	regulation of cellular component organization
GO:0044085	0.580	cellular component biogenesis
GO:0022607	0.524	cellular component assembly
GO:0045921	0.497	positive regulation of exocytosis
GO:0043933	0.454	protein-containing complex organization
GO:0048167	0.453	regulation of synaptic plasticity
GO:0065003	0.437	protein-containing complex assembly
GO:0048583	0.415	regulation of response to stimulus
GO:0046928	0.412	regulation of neurotransmitter secretion
GO:0060341	0.404	regulation of cellular localization
GO:0071322	0.400	cellular response to carbohydrate stimulus
GO:0071333	0.394	cellular response to glucose stimulus
GO:0032501	0.364	multicellular organismal process
GO:0048584	0.333	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098793	1.000	presynapse
GO:0005737	0.999	cytoplasm
GO:0012505	0.993	endomembrane system
GO:0005829	0.993	cytosol
GO:0016020	0.990	membrane
GO:0043226	0.986	organelle
GO:0043227	0.983	membrane-bounded organelle
GO:0005886	0.977	plasma membrane
GO:0043229	0.963	intracellular organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0048786	0.876	presynaptic active zone
GO:0120025	0.861	plasma membrane bounded cell projection
GO:0031982	0.756	vesicle
GO:0043005	0.729	neuron projection
GO:0031410	0.640	cytoplasmic vesicle
GO:0098590	0.588	plasma membrane region
GO:0030424	0.431	axon
GO:0044306	0.421	neuron projection terminus
GO:0150034	0.418	distal axon
GO:0043679	0.411	axon terminus
GO:0097060	0.396	synaptic membrane
GO:0043195	0.322	terminal bouton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]