StarFunc result for job id O14796

User Input

>input (132 residues)
MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKH
GYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETF
VNSNSDYVDVLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14796	1.000	1.000	3.575E-28	132	1.000	1.000	O14796.pdb.gz	SH21B_HUMAN SH2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=SH2D1B PE=1 SV=2
2	AFDB:Q45HK4	0.865	0.865	1.549E-20	132	0.659	0.659	Q45HK4.pdb.gz	SH21C_MOUSE SH2 domain-containing protein 1B2 OS=Mus musculus OX=10090 GN=Sh2d1b2 PE=1 SV=1
3	AFDB:O35324	0.816	0.816	1.679E-19	132	0.652	0.652	O35324.pdb.gz	SH21B_MOUSE SH2 domain-containing protein 1B OS=Mus musculus OX=10090 GN=Sh2d1b PE=1 SV=1
4	AFDB:O60880	0.794	0.819	8.407E-15	128	0.371	0.383	O60880.pdb.gz	SH21A_HUMAN SH2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=SH2D1A PE=1 SV=1
5	AFDB:O88890	0.784	0.820	5.806E-14	126	0.364	0.381	O88890.pdb.gz	SH21A_MOUSE SH2 domain-containing protein 1A OS=Mus musculus OX=10090 GN=Sh2d1a PE=1 SV=1
6	AFDB:D7PF45	0.743	0.083	2.245E-13	1260	0.348	0.037	D7PF45.pdb.gz	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
7	AFDB:Q9ES52	0.742	0.090	4.276E-13	1191	0.341	0.038	Q9ES52.pdb.gz	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2
8	AFDB:W5UIG7	0.696	0.089	6.712E-13	1118	0.371	0.044	W5UIG7.pdb.gz	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
9	AFDB:E7F1C2	0.735	0.097	8.685E-13	1082	0.341	0.042	E7F1C2.pdb.gz
10	PDB:1ka6A	0.739	0.901	1.108E-12	107	0.371	0.458	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
11	AFDB:W5U6G9	0.726	0.083	1.654E-12	1256	0.348	0.037	W5U6G9.pdb.gz	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
12	PDB:4fl2A	0.644	0.165	1.201E-7	555	0.242	0.058	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:1k9aB	0.636	0.202	6.012E-7	441	0.227	0.068	1k9aB.pdb.gz
14	PDB:5xzrA	0.630	0.174	8.296E-7	519	0.242	0.062	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
15	PDB:4gwfA	0.602	0.173	8.848E-7	497	0.242	0.064	4gwfA.pdb.gz
16	PDB:4k2rA	0.635	0.164	1.073E-6	551	0.220	0.053	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:3ps5A	0.616	0.166	3.008E-6	529	0.235	0.059	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
18	PDB:2h8hA	0.611	0.199	6.950E-6	445	0.227	0.067	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:1griA	0.525	0.341	8.432E-6	211	0.220	0.137	1griA.pdb.gz
20	PDB:8dcxB	0.593	0.351	1.164E-5	236	0.197	0.110	8dcxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14796	9.27e-96	273	132	1.000	1.000	SH21B_HUMAN SH2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=SH2D1B PE=1 SV=2
2	O35324	2.43e-62	188	132	0.652	0.652	SH21B_MOUSE SH2 domain-containing protein 1B OS=Mus musculus OX=10090 GN=Sh2d1b PE=1 SV=1
3	Q45HK4	1.20e-60	184	132	0.659	0.659	SH21C_MOUSE SH2 domain-containing protein 1B2 OS=Mus musculus OX=10090 GN=Sh2d1b2 PE=1 SV=1
4	O60880	2.46e-30	107	128	0.364	0.375	SH21A_HUMAN SH2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=SH2D1A PE=1 SV=1
5	O88890	3.88e-30	107	126	0.356	0.373	SH21A_MOUSE SH2 domain-containing protein 1A OS=Mus musculus OX=10090 GN=Sh2d1a PE=1 SV=1
6	A0A0C5AMM3	2.09e-23	96.3	1116	0.341	0.040	A0A0C5AMM3_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
7	W5UIG7	2.44e-23	96.3	1118	0.341	0.040	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
8	Q9ES52	1.02e-21	91.7	1191	0.326	0.036	SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus OX=10090 GN=Inpp5d PE=1 SV=2
9	P97573	1.54e-21	90.9	1190	0.326	0.036	SHIP1_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Inpp5d PE=1 SV=1
10	D7PF45	1.46e-19	85.5	1260	0.326	0.034	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
11	Q6P549	6.48e-19	83.6	1257	0.318	0.033	SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus OX=10090 GN=Inppl1 PE=1 SV=1
12	Q9WVR3	6.80e-19	83.6	1257	0.318	0.033	SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Inppl1 PE=1 SV=1
13	O15357	7.42e-19	83.6	1258	0.318	0.033	SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2
14	Q92835	1.11e-18	82.8	1189	0.303	0.034	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
15	W5U6G9	3.17e-18	81.6	1256	0.318	0.033	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
16	A0A0C5A9Q6	3.47e-18	81.6	1283	0.318	0.033	A0A0C5A9Q6_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (Fragment) OS=Ictalurus punctatus OX=7998 PE=2 SV=1
17	Q2I6J1	4.06e-17	78.6	1266	0.311	0.032	SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio OX=7955 GN=inppl1a PE=2 SV=2
18	G5ECJ6	1.69e-09	56.6	539	0.235	0.058	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
19	Q07883	2.05e-09	55.5	217	0.212	0.129	GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus OX=9031 GN=GRB2 PE=1 SV=1
20	Q60631	2.41e-09	55.1	217	0.212	0.129	GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus OX=10090 GN=Grb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08403 AA_permease_N	2.8e+02	12.5	Amino acid permease N-terminal
2	PF00017 SH2	9.3e-12	56.2	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356906

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357012	0.978	Natural killer cell receptor 2B4
2	9606.ENSP00000312367	0.974	SLAM family member 5
3	9606.ENSP00000306190	0.968	Signaling lymphocytic activation molecule
4	9606.ENSP00000346671	0.956	Tyrosine-protein kinase Fyn
5	9606.ENSP00000357036	0.949	SLAM family member 6
6	9606.ENSP00000357022	0.939	SLAM family member 7
7	9606.ENSP00000293831	0.910	Eukaryotic initiation factor 4A-I
8	9606.ENSP00000244007	0.850	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
9	9606.ENSP00000263285	0.793	T-lymphocyte surface antigen Ly-9
10	9606.ENSP00000482457	0.718	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
11	9606.ENSP00000320184	0.676	Mitochondrial ribosomal protein S23
12	9606.ENSP00000406026	0.668	SH2 domain-containing protein 5
13	9606.ENSP00000484431	0.652	CD48 antigen
14	9606.ENSP00000358490	0.639	T-cell surface antigen CD2
15	9606.ENSP00000308820	0.633	Protein RIC-3
16	9606.ENSP00000261047	0.627	Guanylyl cyclase-activating protein 3
17	9606.ENSP00000371327	0.617	NKG2-C type II integral membrane protein
18	9606.ENSP00000295746	0.614	Protein CIP2A
19	9606.ENSP00000299608	0.611	Protein disulfide-isomerase TMX3
20	9606.ENSP00000341867	0.609	SH2 domain containing 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030674	0.998	protein-macromolecule adaptor activity
GO:0003824	0.503	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0048522	0.992	positive regulation of cellular process
GO:0031347	0.988	regulation of defense response
GO:0050778	0.987	positive regulation of immune response
GO:0002699	0.981	positive regulation of immune effector process
GO:0031341	0.979	regulation of cell killing
GO:0002715	0.977	regulation of natural killer cell mediated immunity
GO:0002705	0.974	positive regulation of leukocyte mediated immunity
GO:0002376	0.967	immune system process
GO:0001910	0.962	regulation of leukocyte mediated cytotoxicity
GO:0045089	0.958	positive regulation of innate immune response
GO:0002252	0.955	immune effector process
GO:0002708	0.954	positive regulation of lymphocyte mediated immunity
GO:0071704	0.950	organic substance metabolic process
GO:0031343	0.948	positive regulation of cell killing
GO:0044238	0.944	primary metabolic process
GO:0048519	0.942	negative regulation of biological process
GO:0001912	0.939	positive regulation of leukocyte mediated cytotoxicity
GO:0042269	0.939	regulation of natural killer cell mediated cytotoxicity
GO:0002683	0.930	negative regulation of immune system process
GO:0002717	0.917	positive regulation of natural killer cell mediated immunity
GO:0019222	0.902	regulation of metabolic process
GO:0018212	0.897	peptidyl-tyrosine modification
GO:0051239	0.888	regulation of multicellular organismal process
GO:0032102	0.886	negative regulation of response to external stimulus
GO:0048523	0.878	negative regulation of cellular process
GO:0051716	0.875	cellular response to stimulus
GO:0044237	0.840	cellular metabolic process
GO:0050865	0.837	regulation of cell activation
GO:0050777	0.836	negative regulation of immune response
GO:0002694	0.833	regulation of leukocyte activation
GO:0007154	0.824	cell communication
GO:0051249	0.819	regulation of lymphocyte activation
GO:0023052	0.811	signaling
GO:0060255	0.810	regulation of macromolecule metabolic process
GO:0006950	0.793	response to stress
GO:0006955	0.789	immune response
GO:0006796	0.780	phosphate-containing compound metabolic process
GO:0002443	0.739	leukocyte mediated immunity
GO:0080090	0.731	regulation of primary metabolic process
GO:0010604	0.730	positive regulation of macromolecule metabolic process
GO:0051171	0.729	regulation of nitrogen compound metabolic process
GO:0007165	0.726	signal transduction
GO:0031323	0.724	regulation of cellular metabolic process
GO:0031348	0.719	negative regulation of defense response
GO:0002449	0.693	lymphocyte mediated immunity
GO:0045954	0.642	positive regulation of natural killer cell mediated cytotoxicity
GO:0051246	0.619	regulation of protein metabolic process
GO:0018108	0.618	peptidyl-tyrosine phosphorylation
GO:0006952	0.613	defense response
GO:0009605	0.609	response to external stimulus
GO:0031325	0.599	positive regulation of cellular metabolic process
GO:0051173	0.596	positive regulation of nitrogen compound metabolic process
GO:0009607	0.589	response to biotic stimulus
GO:0044419	0.584	biological process involved in interspecies interaction between organisms
GO:0032501	0.583	multicellular organismal process
GO:0002704	0.579	negative regulation of leukocyte mediated immunity
GO:0001906	0.578	cell killing
GO:0045937	0.571	positive regulation of phosphate metabolic process
GO:0001909	0.555	leukocyte mediated cytotoxicity
GO:0051247	0.532	positive regulation of protein metabolic process
GO:0050731	0.511	positive regulation of peptidyl-tyrosine phosphorylation
GO:0010468	0.505	regulation of gene expression
GO:0045824	0.505	negative regulation of innate immune response
GO:0051707	0.485	response to other organism
GO:0007166	0.402	cell surface receptor signaling pathway
GO:0002768	0.342	immune response-regulating cell surface receptor signaling pathway
GO:0045321	0.300	leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043227	0.887	membrane-bounded organelle
GO:0043231	0.781	intracellular membrane-bounded organelle
GO:0005634	0.510	nucleus
GO:0016020	0.380	membrane
GO:0071944	0.330	cell periphery
GO:0005886	0.315	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]