StarFunc result for job id O14798

User Input

>input (259 residues)
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY
LSCTIVGIIVLIVLLIVFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14798	1.000	1.000	1.307E-42	259	1.000	1.000	O14798.pdb.gz	TR10C_HUMAN Tumor necrosis factor receptor superfamily member 10C OS=Homo sapiens OX=9606 GN=TNFRSF10C PE=1 SV=3
2	AFDB:Q9UBN6	0.431	0.295	5.825E-20	386	0.463	0.311	Q9UBN6.pdb.gz	TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D OS=Homo sapiens OX=9606 GN=TNFRSF10D PE=1 SV=2
3	AFDB:O14763	0.391	0.236	1.820E-16	440	0.394	0.232	O14763.pdb.gz	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
4	AFDB:O00220	0.413	0.235	1.341E-14	468	0.344	0.190	O00220.pdb.gz	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
5	AFDB:P08138	0.244	0.152	2.730E-9	427	0.208	0.126	P08138.pdb.gz	TNR16_HUMAN Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR PE=1 SV=1
6	AFDB:F1R841	0.271	0.158	1.949E-8	467	0.208	0.116	F1R841.pdb.gz
7	AFDB:P97525	0.193	0.121	8.543E-4	492	0.189	0.100	P97525.pdb.gz	TNR8_RAT Tumor necrosis factor receptor superfamily member 8 OS=Rattus norvegicus OX=10116 GN=Tnfrsf8 PE=2 SV=2
8	AFDB:F1M8Z6	0.335	0.150	1.161E-3	633	0.120	0.049	F1M8Z6.pdb.gz	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
9	PDB:7q3nU	0.183	0.167	4.287E-1	292	0.089	0.079	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
10	AFDB:Q8QG92	0.071	0.029	6.110E-1	824	0.139	0.044	Q8QG92.pdb.gz	DCT1B_XENLA Dapper 1-B OS=Xenopus laevis OX=8355 GN=dact1-b PE=1 SV=1
11	AFDB:Q8NC24	0.104	0.092	1.129	303	0.139	0.119	Q8NC24.pdb.gz	RELL2_HUMAN RELT-like protein 2 OS=Homo sapiens OX=9606 GN=RELL2 PE=1 SV=1
12	PDB:7f3fA	0.070	0.045	3.913	460	0.035	0.020	7f3fA.pdb.gz
13	PDB:7bwaA	0.095	0.050	4.705	674	0.069	0.027	7bwaA.pdb.gz
14	PDB:6pxvA	0.138	0.060	5.003	823	0.100	0.032	6pxvA.pdb.gz
15	PDB:7qdsA	0.086	0.116	5.003	155	0.069	0.116	7qdsA.pdb.gz
16	PDB:7wihA	0.111	0.057	5.657	741	0.042	0.015	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
17	PDB:3duzA	0.075	0.052	6.396	418	0.039	0.024	3duzA.pdb.gz
18	PDB:7mn8B	0.091	0.056	8.178	579	0.069	0.031	7mn8B.pdb.gz
19	PDB:1s4eF	0.059	0.045	9.247	351	0.019	0.014	1s4eF.pdb.gz	Substrate specificity and mechanism from the structure of Pyrococcus furiosus galactokinase
20	PDB:6qvk1e	0.083	0.078	9.247	280	0.035	0.032	6qvk1e.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14798	0.0	525	259	1.000	1.000	TR10C_HUMAN Tumor necrosis factor receptor superfamily member 10C OS=Homo sapiens OX=9606 GN=TNFRSF10C PE=1 SV=3
2	Q9UBN6	7.70e-77	239	386	0.471	0.316	TR10D_HUMAN Tumor necrosis factor receptor superfamily member 10D OS=Homo sapiens OX=9606 GN=TNFRSF10D PE=1 SV=2
3	O00220	3.30e-48	167	468	0.340	0.188	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
4	O14763	1.71e-40	146	440	0.309	0.182	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
5	B8YBG7	2.14e-21	93.6	336	0.170	0.131	B8YBG7_RAT Tumor necrosis factor receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=2 SV=1
6	A0A0G2JZE1	2.46e-21	93.2	336	0.170	0.131	A0A0G2JZE1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
7	A0A1W2Q6I0	3.30e-21	92.8	331	0.170	0.133	A0A1W2Q6I0_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
8	D3ZYZ1	5.51e-18	83.2	267	0.139	0.135	D3ZYZ1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=5
9	Q0PKX6	5.54e-10	61.2	436	0.170	0.101	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
10	Q9ER62	3.82e-08	54.3	198	0.151	0.197	TNR22_MOUSE Tumor necrosis factor receptor superfamily member 22 OS=Mus musculus OX=10090 GN=Tnfrsf22 PE=2 SV=3
11	F1QD95	4.26e-08	55.5	418	0.135	0.084	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1
12	Q9DF34	6.51e-08	55.1	357	0.131	0.095	Q9DF34_DANRE Death receptor OS=Danio rerio OX=7955 GN=zgc:103531 PE=2 SV=1
13	Q6NUU6	1.09e-06	51.2	389	0.124	0.082	Q6NUU6_DANRE Tumor necrosis factor receptor superfamily member 1A precursor OS=Danio rerio OX=7955 GN=zgc:85914 PE=2 SV=1
14	O00300	1.16e-06	51.2	401	0.147	0.095	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
15	F1QG24	1.76e-06	50.4	293	0.181	0.160	F1QG24_DANRE Tumor necrosis factor receptor superfamily member 6 OS=Danio rerio OX=7955 GN=fas PE=4 SV=1
16	Q9ER63	6.04e-06	47.8	176	0.124	0.182	TNR23_MOUSE Tumor necrosis factor receptor superfamily member 23 OS=Mus musculus OX=10090 GN=Tnfrsf23 PE=2 SV=2
17	P19438	9.65e-06	48.5	455	0.116	0.066	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
18	P25445	1.25e-05	48.1	335	0.120	0.093	TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
19	Q63199	1.84e-05	47.4	324	0.097	0.077	TNR6_RAT Tumor necrosis factor receptor superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Fas PE=1 SV=1
20	K9J972	2.28e-05	46.2	197	0.120	0.157	K9J972_HUMAN FAS receptor variant 9 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05808 Podoplanin	1.3e+02	14.3	Podoplanin
2	PF00020 TNFR_c6	2.4e-14	64.8	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349324

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241261	0.996	Tumor necrosis factor ligand superfamily member 10
2	9606.ENSP00000269305	0.944	Cellular tumor antigen p53
3	9606.ENSP00000276431	0.917	Tumor necrosis factor receptor superfamily member 10B
4	9606.ENSP00000221132	0.912	Tumor necrosis factor receptor superfamily member 10A
5	9606.ENSP00000310263	0.909	Tumor necrosis factor receptor superfamily member 10D
6	9606.ENSP00000301838	0.825	FAS-associated death domain protein
7	9606.ENSP00000351273	0.804	Caspase-8
8	9606.ENSP00000312455	0.719	CASP8 and FADD-like apoptosis regulator
9	9606.ENSP00000303356	0.655	L-xylulose reductase
10	9606.ENSP00000286186	0.651	Caspase-10
11	9606.ENSP00000261658	0.648	Bifunctional apoptosis regulator
12	9606.ENSP00000448165	0.610	Apoptotic protease-activating factor 1
13	9606.ENSP00000341268	0.573	Tumor necrosis factor receptor type 1-associated DEATH domain protein
14	9606.ENSP00000311032	0.569	Caspase-3
15	9606.ENSP00000360242	0.563	E3 ubiquitin-protein ligase XIAP
16	9606.ENSP00000356694	0.562	Tumor necrosis factor ligand superfamily member 6
17	9606.ENSP00000362179	0.561	Endoribonuclease ZC3H12A
18	9606.ENSP00000347979	0.554	Tumor necrosis factor receptor superfamily member 6
19	9606.ENSP00000162749	0.517	Tumor necrosis factor receptor superfamily member 1A
20	9606.ENSP00000359013	0.517	Tumor necrosis factor receptor superfamily, member 6b, decoy

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	1.000	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.988	response to stimulus
GO:0051716	0.967	cellular response to stimulus
GO:0007154	0.905	cell communication
GO:0007165	0.895	signal transduction
GO:0048518	0.851	positive regulation of biological process
GO:0048519	0.842	negative regulation of biological process
GO:0048522	0.830	positive regulation of cellular process
GO:0019222	0.741	regulation of metabolic process
GO:0010941	0.644	regulation of cell death
GO:0043067	0.632	regulation of programmed cell death
GO:0042981	0.581	regulation of apoptotic process
GO:0060255	0.532	regulation of macromolecule metabolic process
GO:0048523	0.492	negative regulation of cellular process
GO:0048583	0.432	regulation of response to stimulus
GO:0012501	0.422	programmed cell death
GO:0080090	0.421	regulation of primary metabolic process
GO:0051171	0.421	regulation of nitrogen compound metabolic process
GO:0043069	0.416	negative regulation of programmed cell death
GO:0009893	0.409	positive regulation of metabolic process
GO:0043066	0.402	negative regulation of apoptotic process
GO:0006915	0.379	apoptotic process
GO:0023051	0.370	regulation of signaling
GO:0010646	0.370	regulation of cell communication
GO:0010604	0.358	positive regulation of macromolecule metabolic process
GO:0009966	0.355	regulation of signal transduction
GO:0042221	0.334	response to chemical
GO:0097190	0.311	apoptotic signaling pathway
GO:0051173	0.308	positive regulation of nitrogen compound metabolic process
GO:0051247	0.300	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.783	intracellular anatomical structure
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0005737	0.645	cytoplasm
GO:0005829	0.374	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]