StarFunc result for job id O14802

User Input

>input (1390 residues)
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANF
IQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCPSEPALSKNELILTTESIMKKSEFLC
CQDSFLQEIKKFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQVEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFD
TNEFHIPLVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5fj9A	0.926	0.912	0.000	1412	0.509	0.501	5fj9A.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
2	PDB:6eu2A	0.925	0.918	0.000	1402	0.510	0.506	6eu2A.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
3	PDB:7astN	0.808	0.901	0.000	1238	0.876	0.984	7astN.pdb.gz
4	PDB:7d58A	0.969	0.971	0.000	1387	0.998	1.000	7d58A.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
5	PDB:7dn3A	0.918	0.987	0.000	1293	0.929	0.999	7dn3A.pdb.gz	Structure of human RNA polymerase III elongation complex.
6	PDB:7z1lA	0.956	0.926	0.000	1436	0.523	0.506	7z1lA.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
7	AFDB:A0A1D8PUA6	0.857	0.695	0.000	1728	0.353	0.284	A0A1D8PUA6.pdb.gz	A0A1D8PUA6_CANAL DNA-directed RNA polymerase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPO21 PE=3 SV=1
8	AFDB:A8JUY3	0.980	0.985	0.000	1383	0.570	0.573	A8JUY3.pdb.gz	A8JUY3_DROME DNA-directed RNA polymerase subunit OS=Drosophila melanogaster OX=7227 GN=Polr3A PE=1 SV=2
9	AFDB:B2RXC6	0.991	0.991	0.000	1390	0.979	0.979	B2RXC6.pdb.gz	B2RXC6_MOUSE DNA-directed RNA polymerase subunit OS=Mus musculus OX=10090 GN=Polr3a PE=1 SV=1
10	AFDB:O94666	0.971	0.961	0.000	1405	0.523	0.517	O94666.pdb.gz	RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc1 PE=2 SV=1
11	AFDB:P04051	0.953	0.908	0.000	1460	0.521	0.496	P04051.pdb.gz	RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO31 PE=1 SV=1
12	AFDB:P08968	0.941	0.857	0.000	1530	0.430	0.391	P08968.pdb.gz	RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1
13	AFDB:P35084	0.849	0.687	0.000	1727	0.368	0.296	P35084.pdb.gz	RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum OX=44689 GN=polr2a PE=2 SV=2
14	AFDB:P36594	0.851	0.680	0.000	1752	0.363	0.288	P36594.pdb.gz	RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb1 PE=1 SV=1
15	AFDB:P16356	0.856	0.646	2.243E-103	1856	0.341	0.255	P16356.pdb.gz	RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans OX=6239 GN=ama-1 PE=1 SV=3
16	AFDB:P18616	0.855	0.651	1.199E-102	1839	0.352	0.266	P18616.pdb.gz	NRPB1_ARATH DNA-directed RNA polymerase II subunit RPB1 OS=Arabidopsis thaliana OX=3702 GN=NRPB1 PE=1 SV=3
17	PDB:6o6cA	0.847	0.816	4.174E-95	1446	0.340	0.326	6o6cA.pdb.gz	3.1 angstrom structure of yeast RNA polymerase II elongation complex stalled at a cyclobutane pyrimidine dimer lesion solved using streptavidin affinity grids.
18	PDB:5fywA	0.838	0.834	1.423E-93	1398	0.332	0.330	5fywA.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
19	PDB:7lbmA	0.806	0.772	3.044E-89	1455	0.335	0.320	7lbmA.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
20	PDB:1nt9A	0.829	0.833	1.341E-86	1383	0.329	0.331	1nt9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PUA6	594	1728	0.260	0.209	A0A1D8PUA6_CANAL DNA-directed RNA polymerase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPO21 PE=3 SV=1
2	A0A8I6ASE2	590	1956	0.253	0.179	A0A8I6ASE2_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
3	A8JUY3	1620	1383	0.570	0.573	A8JUY3_DROME DNA-directed RNA polymerase subunit OS=Drosophila melanogaster OX=7227 GN=Polr3A PE=1 SV=2
4	B2RXC6	2833	1390	0.980	0.980	B2RXC6_MOUSE DNA-directed RNA polymerase subunit OS=Mus musculus OX=10090 GN=Polr3a PE=1 SV=1
5	B8YB53	641	880	0.264	0.417	RPO1N_SACSH DNA-directed RNA polymerase subunit Rpo1N OS=Saccharolobus shibatae OX=2286 GN=rpo1N PE=1 SV=1
6	D4A5A6	590	1970	0.253	0.178	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
7	G3MZY8	589	1970	0.253	0.178	G3MZY8_BOVIN DNA-directed RNA polymerase subunit OS=Bos taurus OX=9913 GN=POLR2A PE=1 SV=2
8	O14802	2880	1390	1.000	1.000	RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2
9	O94666	1431	1405	0.522	0.517	RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc1 PE=2 SV=1
10	P04050	704	1733	0.357	0.286	RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO21 PE=1 SV=2
11	P04051	1415	1460	0.524	0.499	RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO31 PE=1 SV=1
12	P08775	589	1970	0.253	0.178	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3
13	P08968	813	1530	0.299	0.272	RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1
14	P11512	650	880	0.261	0.412	RPO1N_SULAC DNA-directed RNA polymerase subunit Rpo1N OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo1N PE=1 SV=2
15	P16356	595	1856	0.250	0.188	RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans OX=6239 GN=ama-1 PE=1 SV=3
16	P18616	606	1839	0.264	0.200	NRPB1_ARATH DNA-directed RNA polymerase II subunit RPB1 OS=Arabidopsis thaliana OX=3702 GN=NRPB1 PE=1 SV=3
17	P24928	589	1970	0.253	0.178	RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2
18	P35084	615	1727	0.259	0.208	RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum OX=44689 GN=polr2a PE=2 SV=2
19	P36594	620	1752	0.267	0.212	RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb1 PE=1 SV=1
20	Q7TSI4	1312	649	0.450	0.965	Q7TSI4_MOUSE DNA-directed RNA polymerase subunit OS=Mus musculus OX=10090 GN=Polr3a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04997 RNA_pol_Rpb1_1	4.2e-94	327.0	RNA polymerase Rpb1, domain 1
2	PF00623 RNA_pol_Rpb1_2	3e-72	253.8	RNA polymerase Rpb1, domain 2
3	PF04983 RNA_pol_Rpb1_3	6.8e-39	144.8	RNA polymerase Rpb1, domain 3
4	PF05000 RNA_pol_Rpb1_4	1.1e-28	110.7	RNA polymerase Rpb1, domain 4
5	PF04998 RNA_pol_Rpb1_5	7.4e-86	299.5	RNA polymerase Rpb1, domain 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228347	0.999	DNA-directed RNA polymerase III subunit RPC2
2	9606.ENSP00000299853	0.999	DNA-directed RNA polymerase III subunit RPC5
3	9606.ENSP00000302478	0.999	DNA-directed RNA polymerases I and III subunit RPAC2
4	9606.ENSP00000334564	0.999	DNA-directed RNA polymerase III subunit RPC3
5	9606.ENSP00000347345	0.999	DNA-directed RNA polymerase III subunit RPC8
6	9606.ENSP00000361465	0.999	DNA-directed RNA polymerases I and III subunit RPAC1
7	9606.ENSP00000366828	0.999	DNA-directed RNA polymerase III subunit RPC6
8	9606.ENSP00000380904	0.999	DNA-directed RNA polymerase III subunit RPC4
9	9606.ENSP00000415536	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC3
10	9606.ENSP00000478303	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
11	9606.ENSP00000293860	0.998	DNA-directed RNA polymerase III subunit RPC10
12	9606.ENSP00000378736	0.998	DNA-directed RNA polymerase III subunit RPC9
13	9606.ENSP00000403852	0.997	DNA-directed RNA polymerases I, II, and III subunit RPABC2
14	9606.ENSP00000324124	0.995	DNA-directed RNA polymerases I, II, and III subunit RPABC5
15	9606.ENSP00000382058	0.988	DNA-directed RNA polymerase III subunit RPC7
16	9606.ENSP00000444136	0.987	DNA-directed RNA polymerase I subunit RPA2
17	9606.ENSP00000263857	0.986	DNA-directed RNA polymerase I subunit RPA1
18	9606.ENSP00000351575	0.986	Transcription factor TFIIIB component B'' homolog
19	9606.ENSP00000318604	0.981	Repressor of RNA polymerase III transcription MAF1 homolog
20	9606.ENSP00000358320	0.972	DNA-directed RNA polymerase III subunit RPC7-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.880	catalytic activity
GO:0140640	0.874	catalytic activity, acting on a nucleic acid
GO:0003899	0.829	DNA-directed 5'-3' RNA polymerase activity
GO:0003676	0.561	nucleic acid binding
GO:0003682	0.380	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0010468	0.957	regulation of gene expression
GO:0048518	0.928	positive regulation of biological process
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0009987	0.885	cellular process
GO:0071704	0.867	organic substance metabolic process
GO:0050896	0.859	response to stimulus
GO:0044238	0.857	primary metabolic process
GO:0006807	0.833	nitrogen compound metabolic process
GO:0044237	0.833	cellular metabolic process
GO:0043170	0.770	macromolecule metabolic process
GO:0034641	0.725	cellular nitrogen compound metabolic process
GO:0050794	0.676	regulation of cellular process
GO:0010467	0.590	gene expression
GO:0006139	0.586	nucleobase-containing compound metabolic process
GO:0016070	0.556	RNA metabolic process
GO:0009607	0.540	response to biotic stimulus
GO:0044271	0.510	cellular nitrogen compound biosynthetic process
GO:0009059	0.507	macromolecule biosynthetic process
GO:0044419	0.504	biological process involved in interspecies interaction between organisms
GO:0006950	0.423	response to stress
GO:0051171	0.401	regulation of nitrogen compound metabolic process
GO:0080090	0.397	regulation of primary metabolic process
GO:0031323	0.396	regulation of cellular metabolic process
GO:0009605	0.374	response to external stimulus
GO:0001817	0.370	regulation of cytokine production
GO:0010556	0.352	regulation of macromolecule biosynthetic process
GO:0006351	0.350	DNA-templated transcription
GO:0010628	0.347	positive regulation of gene expression
GO:0002376	0.310	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:1902494	0.996	catalytic complex
GO:0140535	0.996	intracellular protein-containing complex
GO:0005829	0.996	cytosol
GO:0016020	0.992	membrane
GO:0140513	0.990	nuclear protein-containing complex
GO:0000428	0.987	DNA-directed RNA polymerase complex
GO:0055029	0.971	nuclear DNA-directed RNA polymerase complex
GO:0043228	0.936	non-membrane-bounded organelle
GO:0043232	0.933	intracellular non-membrane-bounded organelle
GO:0005666	0.688	RNA polymerase III complex
GO:0005730	0.342	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	0.829	DNA-directed RNA polymerase.

[back to server]