StarFunc result for job id O14827

User Input

>input (1237 residues)
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGQGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNT
ERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQE
RKAAANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFESLSAMELAEQITLLDHVIFRS
IPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAV
ADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPKVAQYLLDKDLIIDEDTLYELSLKIEPRLPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2X0SFL3	0.575	0.575	0.000	1237	1.000	1.000	A0A2X0SFL3.pdb.gz	A0A2X0SFL3_HUMAN RASGRF2 (Fragment) OS=Homo sapiens OX=9606 GN=RASGRF2 PE=4 SV=1
2	AFDB:P27671	0.530	0.522	0.000	1262	0.649	0.636	P27671.pdb.gz	RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus OX=10090 GN=Rasgrf1 PE=1 SV=2
3	AFDB:Q13972	0.435	0.425	0.000	1273	0.670	0.651	Q13972.pdb.gz	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
4	AFDB:Q99JE4	0.368	0.382	0.000	1190	0.919	0.955	Q99JE4.pdb.gz	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1
5	AFDB:F1R019	0.300	0.278	5.450E-24	1341	0.147	0.136	F1R019.pdb.gz	F1R019_DANRE Son of sevenless homolog 2 OS=Danio rerio OX=7955 GN=si:ch211-67f24.8 PE=1 SV=2
6	AFDB:Q8IS18	0.247	0.294	9.069E-17	1037	0.117	0.140	Q8IS18.pdb.gz	GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum OX=44689 GN=gefE PE=2 SV=1
7	AFDB:Q8IS19	0.277	0.497	4.515E-14	668	0.086	0.160	Q8IS19.pdb.gz	GEFD_DICDI Ras guanine nucleotide exchange factor D OS=Dictyostelium discoideum OX=44689 GN=gefD PE=2 SV=1
8	AFDB:Q8IS16	0.216	0.423	4.612E-13	604	0.057	0.118	Q8IS16.pdb.gz	GEFH_DICDI Ras guanine nucleotide exchange factor H OS=Dictyostelium discoideum OX=44689 GN=gefH PE=1 SV=1
9	AFDB:A0A5F8MPI9	0.210	0.237	2.798E-12	1087	0.149	0.169	A0A5F8MPI9.pdb.gz	A0A5F8MPI9_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
10	PDB:4mt6A	0.225	0.635	1.989E-11	389	0.053	0.170	4mt6A.pdb.gz
11	PDB:2byvE	0.231	0.306	3.629E-11	922	0.058	0.078	2byvE.pdb.gz
12	PDB:4f7zA	0.233	0.302	3.629E-11	946	0.061	0.079	4f7zA.pdb.gz
13	PDB:7rx9A	0.144	0.398	4.803E-11	432	0.062	0.178	7rx9A.pdb.gz
14	AFDB:A1Z6P8	0.231	0.282	4.812E-11	1006	0.065	0.081	A1Z6P8.pdb.gz	A1Z6P8_DROME Exchange protein directly activated by cAMP, isoform E OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=3
15	PDB:4gouA	0.146	0.307	9.928E-7	507	0.040	0.097	4gouA.pdb.gz
16	PDB:3ljuX	0.076	0.239	1.546E-4	373	0.019	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6bbpA	0.080	0.182	3.446E-4	520	0.025	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:6u3eA	0.074	0.221	2.091E-3	397	0.023	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:3uzsA	0.066	0.129	9.584E-3	609	0.019	0.039	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:6hhgA	0.072	0.219	1.431E-2	386	0.019	0.060	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2X0SFL3	0.0	2580	1237	1.000	1.000	A0A2X0SFL3_HUMAN RASGRF2 (Fragment) OS=Homo sapiens OX=9606 GN=RASGRF2 PE=4 SV=1
2	O14827	0.0	2580	1237	1.000	1.000	RGRF2_HUMAN Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens OX=9606 GN=RASGRF2 PE=1 SV=2
3	P27671	0.0	1637	1262	0.659	0.646	RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus OX=10090 GN=Rasgrf1 PE=1 SV=2
4	P28818	0.0	1644	1244	0.667	0.663	RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus OX=10116 GN=Rasgrf1 PE=1 SV=1
5	P70392	0.0	2295	1189	0.912	0.949	RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus OX=10090 GN=Rasgrf2 PE=1 SV=2
6	Q13972	0.0	1666	1273	0.679	0.660	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
7	Q99JE4	0.0	2297	1190	0.916	0.952	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1
8	P26675	8.08e-39	160	1596	0.083	0.065	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
9	Q8IS18	1.02e-38	159	1037	0.091	0.108	GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum OX=44689 GN=gefE PE=2 SV=1
10	Q54PQ4	8.93e-38	153	605	0.085	0.174	GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum OX=44689 GN=gefA PE=1 SV=1
11	B0M0P8	1.30e-36	154	2356	0.066	0.035	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
12	Q02384	4.53e-36	151	1333	0.082	0.076	SOS2_MOUSE Son of sevenless homolog 2 OS=Mus musculus OX=10090 GN=Sos2 PE=1 SV=2
13	Q62245	8.64e-36	150	1319	0.078	0.073	SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus OX=10090 GN=Sos1 PE=1 SV=2
14	Q8IS21	2.29e-35	149	1529	0.073	0.059	GEFB_DICDI Ras guanine nucleotide exchange factor B OS=Dictyostelium discoideum OX=44689 GN=gefB PE=2 SV=1
15	G1TRT1	8.48e-35	147	1304	0.077	0.073	G1TRT1_RABIT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Oryctolagus cuniculus OX=9986 GN=SOS1 PE=4 SV=2
16	Q07890	1.00e-34	147	1332	0.078	0.072	SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens OX=9606 GN=SOS2 PE=1 SV=2
17	A0A8I6B4D6	1.22e-34	147	1283	0.075	0.072	A0A8I6B4D6_RAT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Sos1 PE=1 SV=1
18	A0A0G2JVU2	1.27e-34	147	1300	0.080	0.076	A0A0G2JVU2_RAT SOS Ras/Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Sos2 PE=4 SV=2
19	F1MAI3	1.27e-34	147	1333	0.080	0.074	F1MAI3_RAT SOS Ras/Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Sos2 PE=4 SV=1
20	D4A3T0	2.10e-34	146	1319	0.075	0.071	D4A3T0_RAT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Sos1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16689 APC_N_CC	9.7e+02	11.4	Coiled-coil N-terminus of APC, dimerisation domain
2	PF00612 IQ	41	15.3	IQ calmodulin-binding motif
3	PF00169 PH	1.1e-19	82.2	PH domain
4	PF06810 Phage_GP20	1.9e+02	13.3	Phage minor structural protein GP20
5	PF15413 PH_11	0.25	23.2	Pleckstrin homology domain
6	PF18012 PH_17	3.3e+02	12.5	PH domain
7	PF20399 PH_20	2.6e+02	13.1	PH domain
8	PF00617 RasGEF	5.5e-55	197.9	RasGEF domain
9	PF00618 RasGEF_N	4.6e-22	89.6	RasGEF N-terminal motif
10	PF00621 RhoGEF	3.3e-28	110.6	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256078	0.959	GTPase KRas
2	9606.ENSP00000407586	0.941	GTPase HRas
3	9606.ENSP00000358548	0.929	GTPase NRas
4	9606.ENSP00000348461	0.927	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000359719	0.843	cAMP-dependent protein kinase catalytic subunit beta
6	9606.ENSP00000309591	0.839	cAMP-dependent protein kinase catalytic subunit alpha
7	9606.ENSP00000366488	0.839	cAMP-dependent protein kinase catalytic subunit gamma
8	9606.ENSP00000405963	0.814	Ras-specific guanine nucleotide-releasing factor 1
9	9606.ENSP00000379818	0.801	Glutamate receptor ionotropic, NMDA 2A
10	9606.ENSP00000381412	0.792	Calcium/calmodulin-dependent protein kinase type II subunit alpha
11	9606.ENSP00000246792	0.750	Ras-related protein R-Ras
12	9606.ENSP00000477455	0.749	Glutamate receptor ionotropic, NMDA 2B
13	9606.ENSP00000232564	0.725	Guanine nucleotide-binding protein subunit beta-4
14	9606.ENSP00000289104	0.719	Ras-related protein M-Ras
15	9606.ENSP00000256196	0.718	Ras-related protein R-Ras2
16	9606.ENSP00000427866	0.716	Dematin
17	9606.ENSP00000274376	0.713	Ras GTPase-activating protein 1
18	9606.ENSP00000369674	0.689	B-cell CLL/lymphoma 7 protein family member C
19	9606.ENSP00000365441	0.673	Voltage-dependent L-type calcium channel subunit alpha-1F
20	9606.ENSP00000418081	0.668	Voltage-dependent calcium channel subunit alpha-2/delta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140677	0.999	molecular function activator activity
GO:0005515	0.999	protein binding
GO:0030695	0.998	GTPase regulator activity
GO:0005085	0.984	guanyl-nucleotide exchange factor activity
GO:0005102	0.469	signaling receptor binding
GO:0035254	0.404	glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.990	cellular response to stimulus
GO:0023051	0.990	regulation of signaling
GO:0010646	0.990	regulation of cell communication
GO:0009966	0.973	regulation of signal transduction
GO:0051056	0.880	regulation of small GTPase mediated signal transduction
GO:0065009	0.546	regulation of molecular function
GO:0048518	0.493	positive regulation of biological process
GO:0034976	0.493	response to endoplasmic reticulum stress
GO:0065008	0.473	regulation of biological quality
GO:0007165	0.464	signal transduction
GO:0048522	0.440	positive regulation of cellular process
GO:0051049	0.348	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0016020	0.995	membrane
GO:0043227	0.995	membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005829	0.994	cytosol
GO:0005886	0.993	plasma membrane
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005783	0.869	endoplasmic reticulum
GO:0005634	0.330	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]