StarFunc result for job id O14830

User Input

>input (753 residues)
MGSGTSTQHHFAFQNAERAFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQV
KLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFAQDSEMKKCSDYESIEVPDSYTGPRLS
FPLLPDHATALVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDL
HGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGN
HEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITD
LELLDKIERSKIVSTMRCKTRQKSEKQMEEKRRANQKSSAQGPIPWFLPESRSLPSSPLR
LGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELELERCRQQAGLLVTGEKEEPSRSA
SEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYN
MQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANK
VTHTLTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLITLSDWAAAVESV
LHLGLPWRMLRPQLVNSSADNMLEYKSWLKNLAKEQLSRENIQSSLLETLYRNRSNLETI
FRIIDSDHSGFISLDEFRQTWKLFSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEA
FRLVEKSCPEGDASECPQATNAKDSGCSSPGAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14830	1.000	1.000	0.000	753	1.000	1.000	O14830.pdb.gz	PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens OX=9606 GN=PPEF2 PE=1 SV=2
2	AFDB:O14829	0.782	0.898	2.371E-66	653	0.432	0.498	O14829.pdb.gz	PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1
3	AFDB:G5EBX9	0.745	0.792	5.627E-59	707	0.373	0.397	G5EBX9.pdb.gz	PPE_CAEEL Serine/threonine-protein phosphatase with EF-hands pef-1 OS=Caenorhabditis elegans OX=6239 GN=pef-1 PE=1 SV=1
4	AFDB:P40421	0.625	0.706	6.302E-55	661	0.353	0.402	P40421.pdb.gz	RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster OX=7227 GN=rdgC PE=2 SV=1
5	AFDB:Q4GYH2	0.446	0.376	1.890E-32	925	0.231	0.188	Q4GYH2.pdb.gz	Q4GYH2_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4050 PE=3 SV=1
6	AFDB:Q8ILL9	0.543	0.433	2.352E-31	959	0.228	0.179	Q8ILL9.pdb.gz	Q8ILL9_PLAF7 Serine/threonine-protein phosphatase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1423300 PE=3 SV=1
7	AFDB:Q9NES8	0.414	0.620	3.097E-28	496	0.171	0.260	Q9NES8.pdb.gz	PPP5_CAEEL Serine/threonine-protein phosphatase 5 OS=Caenorhabditis elegans OX=6239 GN=pph-5 PE=1 SV=2
8	PDB:1wao1	0.405	0.638	3.892E-28	471	0.185	0.295	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
9	AFDB:A0A024R0Q7	0.410	0.612	9.701E-28	499	0.185	0.279	A0A024R0Q7.pdb.gz
10	AFDB:Q9VH81	0.411	0.589	1.017E-27	520	0.178	0.258	Q9VH81.pdb.gz	Q9VH81_DROME protein-serine/threonine phosphatase OS=Drosophila melanogaster OX=7227 GN=PpD3 PE=1 SV=1
11	AFDB:Q2U919	0.418	0.648	1.561E-27	478	0.171	0.270	Q2U919.pdb.gz	Q2U919_ASPOR Serine/threonine-protein phosphatase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000208 PE=3 SV=1
12	PDB:7obeA	0.403	0.623	1.379E-26	480	0.179	0.281	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
13	PDB:2nppC	0.355	0.846	1.289E-20	308	0.131	0.321	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
14	PDB:6zejI	0.346	0.726	4.233E-20	351	0.142	0.305	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
15	PDB:1s70A	0.359	0.854	7.855E-20	309	0.127	0.311	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
16	PDB:4or9A	0.361	0.668	2.706E-19	399	0.135	0.256	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
17	PDB:4il1A	0.363	0.511	2.919E-18	529	0.141	0.200	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
18	PDB:1g5bB	0.147	0.447	6.598E-6	221	0.046	0.158	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:3fwbA	0.124	0.376	3.657E-5	153	0.040	0.196	3fwbA.pdb.gz
20	PDB:2ggmA	0.101	0.415	7.465E-5	149	0.035	0.174	2ggmA.pdb.gz	The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14830	0.0	1575	753	1.000	1.000	PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens OX=9606 GN=PPEF2 PE=1 SV=2
2	O14829	4.37e-104	335	653	0.212	0.245	PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1
3	G5EBX9	9.16e-89	296	707	0.187	0.199	PPE_CAEEL Serine/threonine-protein phosphatase with EF-hands pef-1 OS=Caenorhabditis elegans OX=6239 GN=pef-1 PE=1 SV=1
4	P40421	7.22e-81	273	661	0.177	0.201	RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster OX=7227 GN=rdgC PE=2 SV=1
5	Q9NES8	4.13e-45	171	496	0.109	0.165	PPP5_CAEEL Serine/threonine-protein phosphatase 5 OS=Caenorhabditis elegans OX=6239 GN=pph-5 PE=1 SV=2
6	Q60676	2.94e-44	169	499	0.122	0.184	PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus OX=10090 GN=Ppp5c PE=1 SV=3
7	P53042	3.15e-44	168	499	0.122	0.184	PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Ppp5c PE=1 SV=1
8	P53041	6.82e-44	167	499	0.121	0.182	PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1
9	Q9VH81	1.02e-42	164	520	0.114	0.165	Q9VH81_DROME protein-serine/threonine phosphatase OS=Drosophila melanogaster OX=7227 GN=PpD3 PE=1 SV=1
10	Q84XU2	6.23e-42	162	538	0.110	0.154	PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PAPP5 PE=1 SV=1
11	Q2U919	3.92e-38	150	478	0.106	0.167	Q2U919_ASPOR Serine/threonine-protein phosphatase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000208 PE=3 SV=1
12	Q388N2	1.35e-36	146	472	0.110	0.176	Q388N2_TRYB2 Serine/threonine-protein phosphatase 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0110 PE=3 SV=1
13	Q4GYH2	3.28e-31	133	925	0.082	0.067	Q4GYH2_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4050 PE=3 SV=1
14	P23880	1.85e-30	124	322	0.080	0.186	PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sds21 PE=3 SV=1
15	P91420	1.10e-29	122	305	0.077	0.190	GLC7D_CAEEL Serine/threonine-protein phosphatase PP1-delta OS=Caenorhabditis elegans OX=6239 GN=gsp-4 PE=2 SV=1
16	P13681	1.48e-29	122	327	0.078	0.180	PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis2 PE=1 SV=1
17	Q585J4	1.62e-29	122	326	0.096	0.221	Q585J4_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.380 PE=3 SV=1
18	O82734	1.66e-29	122	324	0.094	0.219	PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana OX=3702 GN=TOPP8 PE=1 SV=3
19	Q585I6	1.77e-29	121	294	0.077	0.197	Q585I6_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.540 PE=3 SV=1
20	P30366	1.98e-29	121	318	0.084	0.198	PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=TOPP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	2.7e-11	53.2	EF hand
2	PF13202 EF-hand_5	4e-05	34.1	EF hand
3	PF13405 EF-hand_6	2.9e-10	50.1	EF-hand domain
4	PF13499 EF-hand_7	7.4e-08	44.1	EF-hand domain pair
5	PF13833 EF-hand_8	4.4e-07	40.9	EF-hand domain pair
6	PF00612 IQ	6.2	17.9	IQ calmodulin-binding motif
7	PF00149 Metallophos	4.3e-23	94.4	Calcineurin-like phosphoesterase
8	PF08321 PPP5	4.1e-05	35.1	PPP5 TPR repeat region
9	PF04815 Sec23_helical	2.1e+02	13.2	Sec23/Sec24 helical domain
10	PF10591 SPARC_Ca_bdg	4.5e+02	12.6	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286719

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438264	0.677	Leucine rich repeat, Ig-like and transmembrane domains 2
2	9606.ENSP00000296271	0.666	Rhodopsin
3	9606.ENSP00000355480	0.649	EF-hand calcium-binding domain-containing protein 2
4	9606.ENSP00000315743	0.643	Cyclin-G2
5	9606.ENSP00000349467	0.605	Calmodulin-1
6	9606.ENSP00000372326	0.583	Ferrochelatase, mitochondrial
7	9606.ENSP00000361177	0.562	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1
8	9606.ENSP00000365963	0.527	Protein phosphatase 1 regulatory subunit 11
9	9606.ENSP00000254442	0.517	WD repeat-containing protein 7
10	9606.ENSP00000272298	0.512	Calmodulin 2 (phosphorylase kinase, delta)
11	9606.ENSP00000291295	0.507	Calmodulin 3 (phosphorylase kinase, delta)
12	9606.ENSP00000234038	0.506	Protein phosphatase 1 regulatory subunit 7
13	9606.ENSP00000324464	0.504	Casein kinase I isoform delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0019901	0.998	protein kinase binding
GO:0051879	0.996	Hsp90 protein binding
GO:0030544	0.991	Hsp70 protein binding
GO:0031435	0.991	mitogen-activated protein kinase kinase kinase binding
GO:0043167	0.543	ion binding
GO:0046872	0.528	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0006793	0.993	phosphorus metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0010646	0.975	regulation of cell communication
GO:0016311	0.973	dephosphorylation
GO:0023051	0.964	regulation of signaling
GO:0048583	0.914	regulation of response to stimulus
GO:1901564	0.901	organonitrogen compound metabolic process
GO:0019538	0.870	protein metabolic process
GO:0036211	0.863	protein modification process
GO:0009966	0.853	regulation of signal transduction
GO:0006470	0.769	protein dephosphorylation
GO:0019222	0.733	regulation of metabolic process
GO:0048519	0.730	negative regulation of biological process
GO:0031323	0.722	regulation of cellular metabolic process
GO:0060255	0.687	regulation of macromolecule metabolic process
GO:0051171	0.687	regulation of nitrogen compound metabolic process
GO:0080090	0.679	regulation of primary metabolic process
GO:0048523	0.679	negative regulation of cellular process
GO:0019220	0.486	regulation of phosphate metabolic process
GO:0051246	0.452	regulation of protein metabolic process
GO:1902531	0.439	regulation of intracellular signal transduction
GO:0023057	0.431	negative regulation of signaling
GO:0010648	0.428	negative regulation of cell communication
GO:0031399	0.402	regulation of protein modification process
GO:0065009	0.379	regulation of molecular function
GO:0050896	0.337	response to stimulus
GO:0031324	0.305	negative regulation of cellular metabolic process
GO:0009968	0.302	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.964	cytosol
GO:0043231	0.845	intracellular membrane-bounded organelle
GO:0005634	0.599	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]