StarFunc result for job id O14841

User Input

>input (1288 residues)
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAG
MLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFD
LAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDLLEVQQPVDLGALRGKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSAT
TYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYA
PETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATA
RSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGLRLEDAPKAQTGPPRVD
KMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICIS
VGAEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEA
LRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEV
FGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRA
FRPYGLHGGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
PPPGSPPQALAFPEHGSVYEYRRAQEAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14841	1.000	1.000	0.000	1288	1.000	1.000	O14841.pdb.gz	OPLA_HUMAN 5-oxoprolinase OS=Homo sapiens OX=9606 GN=OPLAH PE=1 SV=3
2	AFDB:P28273	0.941	0.943	0.000	1286	0.481	0.481	P28273.pdb.gz	OPLA_YEAST 5-oxoprolinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXP1 PE=1 SV=2
3	AFDB:P95223	0.899	0.957	0.000	1209	0.438	0.467	P95223.pdb.gz	P95223_MYCTU Probable 5-oxoprolinase OplA (5-oxo-L-prolinase) (Pyroglutamase) (5-OPASE) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=oplA PE=1 SV=2
4	AFDB:Q10093	0.932	0.953	0.000	1260	0.495	0.506	Q10093.pdb.gz	YAOE_SCHPO Uncharacterized protein C11D3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.14c PE=3 SV=1
5	AFDB:Q10094	0.950	0.929	0.000	1317	0.521	0.509	Q10094.pdb.gz	YAOF_SCHPO Uncharacterized protein C11D3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.15 PE=3 SV=1
6	AFDB:Q9FIZ7	0.959	0.976	0.000	1266	0.566	0.576	Q9FIZ7.pdb.gz	OPLA_ARATH 5-oxoprolinase 1 OS=Arabidopsis thaliana OX=3702 GN=OXP1 PE=1 SV=1
7	AFDB:Q01262	0.486	0.890	6.553E-52	690	0.165	0.307	Q01262.pdb.gz	HYUA_PSESN Putative D-/L-hydantoinase subunit A OS=Pseudomonas sp. (strain NS671) OX=29441 GN=hyuA PE=3 SV=1
8	PDB:5svcB	0.437	0.745	8.168E-42	710	0.122	0.221	5svcB.pdb.gz	Structural Basis for the Mechanism of ATP-Dependent Acetone Carboxylation.
9	AFDB:Q8RM04	0.425	0.713	9.231E-41	717	0.123	0.222	Q8RM04.pdb.gz	ACXA_XANP2 Acetone carboxylase beta subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=acxA PE=1 SV=1
10	AFDB:Q01263	0.375	0.802	5.206E-38	592	0.112	0.243	Q01263.pdb.gz	HYUB_PSESN Putative D-/L-hydantoinase subunit B OS=Pseudomonas sp. (strain NS671) OX=29441 GN=hyuB PE=3 SV=1
11	AFDB:Q8RM03	0.367	0.599	4.635E-26	776	0.078	0.129	Q8RM03.pdb.gz	ACXB_XANP2 Acetone carboxylase alpha subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=acxB PE=1 SV=1
12	PDB:5svcA	0.364	0.602	6.157E-25	763	0.079	0.134	5svcA.pdb.gz	Structural Basis for the Mechanism of ATP-Dependent Acetone Carboxylation.
13	PDB:2cgjA	0.144	0.331	1.844E-3	479	0.056	0.150	2cgjA.pdb.gz	Structure and Reaction Mechanism of L-Rhamnulose Kinase from Escherichia Coli.
14	PDB:5ya0A	0.138	0.299	1.844E-3	480	0.054	0.144	5ya0A.pdb.gz
15	PDB:3slcA	0.106	0.267	1.933E-3	401	0.042	0.135	3slcA.pdb.gz
16	PDB:7x3kB	0.118	0.263	2.822E-3	506	0.049	0.125	7x3kB.pdb.gz
17	PDB:4bc2A	0.152	0.311	3.928E-3	528	0.052	0.127	4bc2A.pdb.gz	Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
18	PDB:4a62A	0.122	0.419	6.608E-3	320	0.043	0.172	4a62A.pdb.gz	A Bipolar Spindle of Antiparallel Parm Filaments Drives Bacterial Plasmid Segregation.
19	PDB:6sr6C	0.118	0.251	9.200E-3	524	0.057	0.139	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
20	PDB:2d0oA	0.143	0.274	1.165E-2	606	0.072	0.153	2d0oA.pdb.gz	Release of a damaged cofactor from a coenzyme B12-dependent enzyme: X-ray structures of diol dehydratase-reactivating factor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14841	0.0	2608	1288	1.000	1.000	OPLA_HUMAN 5-oxoprolinase OS=Homo sapiens OX=9606 GN=OPLAH PE=1 SV=3
2	P28273	0.0	1198	1286	0.488	0.488	OPLA_YEAST 5-oxoprolinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXP1 PE=1 SV=2
3	P95223	0.0	1007	1209	0.445	0.474	P95223_MYCTU Probable 5-oxoprolinase OplA (5-oxo-L-prolinase) (Pyroglutamase) (5-OPASE) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=oplA PE=1 SV=2
4	Q10093	0.0	1259	1260	0.501	0.512	YAOE_SCHPO Uncharacterized protein C11D3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.14c PE=3 SV=1
5	Q10094	0.0	1247	1317	0.516	0.505	YAOF_SCHPO Uncharacterized protein C11D3.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11D3.15 PE=3 SV=1
6	Q9FIZ7	0.0	1442	1266	0.571	0.581	OPLA_ARATH 5-oxoprolinase 1 OS=Arabidopsis thaliana OX=3702 GN=OXP1 PE=1 SV=1
7	Q01262	4.23e-77	272	690	0.173	0.323	HYUA_PSESN Putative D-/L-hydantoinase subunit A OS=Pseudomonas sp. (strain NS671) OX=29441 GN=hyuA PE=3 SV=1
8	Q01263	2.13e-46	179	592	0.120	0.262	HYUB_PSESN Putative D-/L-hydantoinase subunit B OS=Pseudomonas sp. (strain NS671) OX=29441 GN=hyuB PE=3 SV=1
9	Q8RM04	2.17e-24	112	717	0.120	0.216	ACXA_XANP2 Acetone carboxylase beta subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=acxA PE=1 SV=1
10	Q8RM03	3.42e-14	80.1	776	0.088	0.146	ACXB_XANP2 Acetone carboxylase alpha subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=acxB PE=1 SV=1
11	Q729V7	6.42e-07	56.2	550	0.071	0.165	Q729V7_DESVH Hydantoinase/oxoprolinase family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2240 PE=1 SV=1
12	Q8GZ26	3.0	34.3	429	0.018	0.054	BRN2L_ARATH RNA-binding protein BRN2 OS=Arabidopsis thaliana OX=3702 GN=BRN2 PE=1 SV=1
13	F4I0X0	3.1	34.3	438	0.018	0.053	F4I0X0_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=BRN2 PE=1 SV=1
14	P38433	4.6	33.9	620	0.022	0.045	ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans OX=6239 GN=ace-1 PE=1 SV=1
15	Q99M64	5.6	33.5	478	0.016	0.044	P4K2A_RAT Phosphatidylinositol 4-kinase type 2-alpha OS=Rattus norvegicus OX=10116 GN=Pi4k2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01968 Hydantoinase_A	6.2e-102	352.3	Hydantoinase/oxoprolinase
2	PF02538 Hydantoinase_B	1.5e-212	718.3	Hydantoinase B/oxoprolinase
3	PF19278 Hydant_A_C	0.00011	33.2	Hydantoinase/oxoprolinase C-terminal domain
4	PF05378 Hydant_A_N	8.5e-58	206.5	Hydantoinase/oxoprolinase N-terminal region
5	PF00627 UBA	6e+02	11.8	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275428	0.964	Gamma-glutamylcyclotransferase
2	9606.ENSP00000383232	0.954	Glutathione hydrolase 1 proenzyme
3	9606.ENSP00000338964	0.948	Glutathione hydrolase 7
4	9606.ENSP00000381340	0.943	Glutathione hydrolase 5 proenzyme
5	9606.ENSP00000370962	0.940	Glutathione hydrolase 6
6	9606.ENSP00000229416	0.929	Glutamate-cysteine ligase catalytic subunit
7	9606.ENSP00000295304	0.922	Glutathione-specific gamma-glutamylcyclotransferase 2
8	9606.ENSP00000359258	0.912	Glutamate-cysteine ligase modifier subunit
9	9606.ENSP00000398105	0.903	Glutathione-specific gamma-glutamylcyclotransferase 1
10	9606.ENSP00000277865	0.884	Glutamate dehydrogenase 1, mitochondrial
11	9606.ENSP00000327589	0.873	Glutamate dehydrogenase 2, mitochondrial
12	9606.ENSP00000364490	0.861	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
13	9606.ENSP00000310447	0.854	Glutaminase liver isoform, mitochondrial
14	9606.ENSP00000317379	0.839	Glutaminase kidney isoform, mitochondrial
15	9606.ENSP00000307900	0.820	Glutamine synthetase
16	9606.ENSP00000350928	0.807	Glutamate decarboxylase 1
17	9606.ENSP00000365437	0.802	Glutamate decarboxylase 2
18	9606.ENSP00000007390	0.723	Ribosome biogenesis protein TSR3 homolog
19	9606.ENSP00000297579	0.722	DDB1- and CUL4-associated factor 13
20	9606.ENSP00000216366	0.711	AP-4 complex subunit sigma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0017168	1.000	5-oxoprolinase (ATP-hydrolyzing) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0009056	0.828	catabolic process
GO:0009987	0.809	cellular process
GO:0006807	0.770	nitrogen compound metabolic process
GO:0044237	0.747	cellular metabolic process
GO:1901575	0.570	organic substance catabolic process
GO:1901564	0.507	organonitrogen compound metabolic process
GO:0006749	0.400	glutathione metabolic process
GO:0044238	0.313	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.939	organelle
GO:0043227	0.879	membrane-bounded organelle
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0070013	0.374	intracellular organelle lumen
GO:0005634	0.301	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10348	1.000	5-oxo-L-proline + ATP + 2 H2O = ADP + H(+) + L-glutamate + phosphate
EC:3.5.2.9	1.000	5-oxoprolinase (ATP-hydrolyzing).

[back to server]