StarFunc result for job id O14842

User Input

>input (300 residues)
MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14842	1.000	1.000	1.425E-41	300	1.000	1.000	O14842.pdb.gz	FFAR1_HUMAN Free fatty acid receptor 1 OS=Homo sapiens OX=9606 GN=FFAR1 PE=1 SV=1
2	AFDB:Q76JU9	0.967	0.967	5.556E-37	300	0.830	0.830	Q76JU9.pdb.gz	FFAR1_MOUSE Free fatty acid receptor 1 OS=Mus musculus OX=10090 GN=Ffar1 PE=1 SV=1
3	PDB:5tzrA	0.892	0.614	8.213E-31	437	0.897	0.616	5tzrA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.
4	PDB:5tzyA	0.894	0.645	5.251E-30	418	0.903	0.648	5tzyA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.
5	AFDB:O15552	0.778	0.711	7.509E-15	330	0.273	0.248	O15552.pdb.gz	FFAR2_HUMAN Free fatty acid receptor 2 OS=Homo sapiens OX=9606 GN=FFAR2 PE=1 SV=1
6	AFDB:Q76EI6	0.785	0.716	9.998E-14	330	0.277	0.252	Q76EI6.pdb.gz	FFAR2_RAT Free fatty acid receptor 2 OS=Rattus norvegicus OX=10116 GN=Ffar2 PE=1 SV=1
7	AFDB:P25116	0.781	0.560	3.070E-13	425	0.217	0.153	P25116.pdb.gz	PAR1_HUMAN Proteinase-activated receptor 1 OS=Homo sapiens OX=9606 GN=F2R PE=1 SV=2
8	AFDB:O14843	0.801	0.699	1.652E-12	346	0.297	0.257	O14843.pdb.gz	FFAR3_HUMAN Free fatty acid receptor 3 OS=Homo sapiens OX=9606 GN=FFAR3 PE=1 SV=1
9	AFDB:P26824	0.782	0.553	2.049E-12	432	0.190	0.132	P26824.pdb.gz	PAR1_RAT Proteinase-activated receptor 1 OS=Rattus norvegicus OX=10116 GN=F2r PE=2 SV=1
10	AFDB:Q3U6B2	0.772	0.656	2.655E-12	357	0.210	0.176	Q3U6B2.pdb.gz	GP183_MOUSE G-protein coupled receptor 183 OS=Mus musculus OX=10090 GN=Gpr183 PE=1 SV=1
11	AFDB:Q8BUD0	0.774	0.643	4.652E-12	365	0.243	0.200	Q8BUD0.pdb.gz	GPR4_MOUSE G-protein coupled receptor 4 OS=Mus musculus OX=10090 GN=Gpr4 PE=2 SV=1
12	AFDB:A2BIP6	0.796	0.590	5.529E-12	413	0.230	0.167	A2BIP6.pdb.gz	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
13	PDB:7f1qR	0.720	0.599	9.907E-10	367	0.193	0.158	7f1qR.pdb.gz
14	PDB:3vw7A	0.746	0.518	1.461E-9	442	0.213	0.145	3vw7A.pdb.gz	High-resolution crystal structure of human protease-activated receptor 1
15	PDB:7vl9R	0.741	0.736	1.892E-9	302	0.203	0.202	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
16	PDB:7tuzR	0.712	0.748	6.905E-9	284	0.203	0.215	7tuzR.pdb.gz	Structures of oxysterol sensor EBI2/GPR183, a key regulator of the immune response.
17	PDB:7wicR	0.754	0.782	7.860E-9	288	0.183	0.191	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
18	PDB:8ef5M	0.734	0.762	1.063E-8	288	0.187	0.194	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
19	PDB:7eibA	0.736	0.747	1.159E-8	295	0.197	0.200	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
20	PDB:7wq3R	0.733	0.759	1.210E-8	289	0.180	0.187	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14842	0.0	583	300	1.000	1.000	FFAR1_HUMAN Free fatty acid receptor 1 OS=Homo sapiens OX=9606 GN=FFAR1 PE=1 SV=1
2	Q76JU9	7.89e-172	479	300	0.830	0.830	FFAR1_MOUSE Free fatty acid receptor 1 OS=Mus musculus OX=10090 GN=Ffar1 PE=1 SV=1
3	Q8K3T4	6.25e-170	474	300	0.817	0.817	FFAR1_RAT Free fatty acid receptor 1 OS=Rattus norvegicus OX=10116 GN=Ffar1 PE=2 SV=1
4	O15529	1.61e-32	124	346	0.300	0.260	GPR42_HUMAN G-protein coupled receptor 42 OS=Homo sapiens OX=9606 GN=GPR42 PE=1 SV=2
5	O14843	3.64e-30	118	346	0.307	0.266	FFAR3_HUMAN Free fatty acid receptor 3 OS=Homo sapiens OX=9606 GN=FFAR3 PE=1 SV=1
6	Q8VCK6	6.32e-26	106	330	0.300	0.273	FFAR2_MOUSE Free fatty acid receptor 2 OS=Mus musculus OX=10090 GN=Ffar2 PE=1 SV=1
7	Q76EI6	1.19e-25	105	330	0.330	0.300	FFAR2_RAT Free fatty acid receptor 2 OS=Rattus norvegicus OX=10116 GN=Ffar2 PE=1 SV=1
8	O15552	1.36e-25	105	330	0.287	0.261	FFAR2_HUMAN Free fatty acid receptor 2 OS=Homo sapiens OX=9606 GN=FFAR2 PE=1 SV=1
9	B2GV46	3.15e-24	102	319	0.277	0.260	FFAR3_RAT Free fatty acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Ffar3 PE=1 SV=1
10	Q08AU6	1.01e-23	100	319	0.293	0.276	Q08AU6_MOUSE Ffar3 protein OS=Mus musculus OX=10090 GN=Ffar3 PE=2 SV=1
11	Q3UFD7	1.01e-23	100	319	0.293	0.276	FFAR3_MOUSE Free fatty acid receptor 3 OS=Mus musculus OX=10090 GN=Ffar3 PE=1 SV=1
12	A2BIP6	1.25e-19	90.5	413	0.253	0.184	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
13	P30558	1.09e-15	79.0	430	0.200	0.140	PAR1_MOUSE Proteinase-activated receptor 1 OS=Mus musculus OX=10090 GN=F2r PE=1 SV=2
14	A5PLE7	4.82e-15	76.6	368	0.200	0.163	GP83A_DANRE G-protein coupled receptor 183-A OS=Danio rerio OX=7955 GN=gpr183a PE=2 SV=1
15	Q8BMC0	5.64e-15	76.3	344	0.213	0.186	LPAR6_MOUSE Lysophosphatidic acid receptor 6 OS=Mus musculus OX=10090 GN=Lpar6 PE=1 SV=1
16	P26824	6.98e-15	76.6	432	0.190	0.132	PAR1_RAT Proteinase-activated receptor 1 OS=Rattus norvegicus OX=10116 GN=F2r PE=2 SV=1
17	P25116	1.00e-14	76.3	425	0.223	0.158	PAR1_HUMAN Proteinase-activated receptor 1 OS=Homo sapiens OX=9606 GN=F2R PE=1 SV=2
18	Q13304	6.30e-14	73.6	367	0.190	0.155	GPR17_HUMAN Uracil nucleotide/cysteinyl leukotriene receptor OS=Homo sapiens OX=9606 GN=GPR17 PE=1 SV=2
19	Q3U6B2	8.47e-14	73.2	357	0.130	0.109	GP183_MOUSE G-protein coupled receptor 183 OS=Mus musculus OX=10090 GN=Gpr183 PE=1 SV=1
20	O08675	1.01e-13	72.8	369	0.220	0.179	PAR3_MOUSE Proteinase-activated receptor 3 OS=Mus musculus OX=10090 GN=F2rl2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	7.7e-17	73.0	7 transmembrane receptor (rhodopsin family)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246553

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.997	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000350005	0.958	Gastric inhibitory polypeptide
3	9606.ENSP00000360538	0.939	Free fatty acid receptor 4
4	9606.ENSP00000387662	0.871	Glucagon
5	9606.ENSP00000276218	0.859	Glucose-dependent insulinotropic receptor
6	9606.ENSP00000078429	0.817	Guanine nucleotide-binding protein subunit alpha-11
7	9606.ENSP00000329684	0.816	Galanin receptor type 2
8	9606.ENSP00000085219	0.773	B-cell receptor CD22
9	9606.ENSP00000299727	0.769	Galanin receptor type 1
10	9606.ENSP00000265643	0.765	Galanin peptides
11	9606.ENSP00000450310	0.763	G-protein coupled receptor 84
12	9606.ENSP00000260402	0.740	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
13	9606.ENSP00000380432	0.695	Insulin
14	9606.ENSP00000365807	0.657	Guanine nucleotide-binding protein subunit alpha-14
15	9606.ENSP00000346158	0.654	Regenerating islet-derived protein 4
16	9606.ENSP00000338185	0.652	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
17	9606.ENSP00000443631	0.650	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
18	9606.ENSP00000352882	0.634	Plexin-A4
19	9606.ENSP00000262958	0.626	Guanine nucleotide-binding protein subunit alpha-15
20	9606.ENSP00000331867	0.621	Taste receptor type 1 member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045125	0.999	bioactive lipid receptor activity
GO:0005488	0.991	binding
GO:0005515	0.975	protein binding
GO:0008528	0.444	G protein-coupled peptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.997	signaling
GO:0032879	0.997	regulation of localization
GO:0051716	0.988	cellular response to stimulus
GO:0007154	0.987	cell communication
GO:0051049	0.984	regulation of transport
GO:0007165	0.984	signal transduction
GO:0065008	0.976	regulation of biological quality
GO:0051050	0.968	positive regulation of transport
GO:0007186	0.967	G protein-coupled receptor signaling pathway
GO:0042221	0.964	response to chemical
GO:0051924	0.947	regulation of calcium ion transport
GO:0043270	0.914	positive regulation of monoatomic ion transport
GO:0051928	0.899	positive regulation of calcium ion transport
GO:0007204	0.844	positive regulation of cytosolic calcium ion concentration
GO:0048522	0.467	positive regulation of cellular process
GO:0019222	0.334	regulation of metabolic process
GO:0010033	0.317	response to organic substance
GO:0048519	0.312	negative regulation of biological process
GO:0032501	0.307	multicellular organismal process
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]