StarFunc result for job id O14843

User Input

>input (346 residues)
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTAS
DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP
LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAI
LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGP
YNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ
WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14843	1.000	1.000	5.670E-43	346	1.000	1.000	O14843.pdb.gz	FFAR3_HUMAN Free fatty acid receptor 3 OS=Homo sapiens OX=9606 GN=FFAR3 PE=1 SV=1
2	AFDB:B2GV46	0.815	0.882	4.792E-29	319	0.697	0.755	B2GV46.pdb.gz	FFAR3_RAT Free fatty acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Ffar3 PE=1 SV=1
3	AFDB:Q76EI6	0.799	0.837	2.691E-20	330	0.396	0.415	Q76EI6.pdb.gz	FFAR2_RAT Free fatty acid receptor 2 OS=Rattus norvegicus OX=10116 GN=Ffar2 PE=1 SV=1
4	AFDB:O15552	0.788	0.824	9.358E-20	330	0.384	0.403	O15552.pdb.gz	FFAR2_HUMAN Free fatty acid receptor 2 OS=Homo sapiens OX=9606 GN=FFAR2 PE=1 SV=1
5	AFDB:A0A2R8PXK8	0.736	0.724	2.184E-13	352	0.260	0.256	A0A2R8PXK8.pdb.gz
6	AFDB:Q8BLG2	0.732	0.687	2.689E-13	370	0.275	0.257	Q8BLG2.pdb.gz	LPAR4_MOUSE Lysophosphatidic acid receptor 4 OS=Mus musculus OX=10090 GN=Lpar4 PE=2 SV=2
7	AFDB:A2BIP6	0.776	0.654	1.059E-12	413	0.231	0.194	A2BIP6.pdb.gz	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
8	AFDB:Q149R9	0.734	0.685	1.151E-12	372	0.315	0.293	Q149R9.pdb.gz	LPAR5_MOUSE Lysophosphatidic acid receptor 5 OS=Mus musculus OX=10090 GN=Lpar5 PE=2 SV=2
9	AFDB:Q76JU9	0.698	0.801	1.303E-12	300	0.260	0.300	Q76JU9.pdb.gz	FFAR1_MOUSE Free fatty acid receptor 1 OS=Mus musculus OX=10090 GN=Ffar1 PE=1 SV=1
10	AFDB:P43657	0.721	0.724	3.838E-12	344	0.228	0.230	P43657.pdb.gz	LPAR6_HUMAN Lysophosphatidic acid receptor 6 OS=Homo sapiens OX=9606 GN=LPAR6 PE=1 SV=3
11	PDB:7eibA	0.677	0.784	5.887E-9	295	0.185	0.217	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
12	PDB:7ezmD	0.671	0.755	6.669E-9	304	0.179	0.204	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
13	PDB:5tzrA	0.644	0.516	1.098E-8	437	0.249	0.197	5tzrA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.
14	PDB:5tzyA	0.670	0.559	1.193E-8	418	0.246	0.203	5tzyA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.
15	PDB:6lw5A	0.674	0.555	1.408E-8	427	0.179	0.145	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
16	PDB:6iblA	0.646	0.569	1.734E-8	397	0.156	0.136	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
17	PDB:7cmuR	0.628	0.782	1.734E-8	272	0.188	0.239	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
18	PDB:7mbyR	0.646	0.777	1.734E-8	283	0.188	0.230	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
19	PDB:3vw7A	0.545	0.430	2.047E-8	442	0.234	0.183	3vw7A.pdb.gz	High-resolution crystal structure of human protease-activated receptor 1
20	PDB:5nddA	0.727	0.452	2.047E-8	567	0.240	0.146	5nddA.pdb.gz	Structural insight into allosteric modulation of protease-activated receptor 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14843	0.0	706	346	1.000	1.000	FFAR3_HUMAN Free fatty acid receptor 3 OS=Homo sapiens OX=9606 GN=FFAR3 PE=1 SV=1
2	O15529	0.0	692	346	0.983	0.983	GPR42_HUMAN G-protein coupled receptor 42 OS=Homo sapiens OX=9606 GN=GPR42 PE=1 SV=2
3	B2GV46	4.20e-167	470	319	0.697	0.755	FFAR3_RAT Free fatty acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Ffar3 PE=1 SV=1
4	Q08AU6	1.89e-165	466	319	0.702	0.762	Q08AU6_MOUSE Ffar3 protein OS=Mus musculus OX=10090 GN=Ffar3 PE=2 SV=1
5	Q3UFD7	1.89e-165	466	319	0.702	0.762	FFAR3_MOUSE Free fatty acid receptor 3 OS=Mus musculus OX=10090 GN=Ffar3 PE=1 SV=1
6	Q8VCK6	1.25e-72	230	330	0.393	0.412	FFAR2_MOUSE Free fatty acid receptor 2 OS=Mus musculus OX=10090 GN=Ffar2 PE=1 SV=1
7	Q76EI6	2.97e-72	229	330	0.399	0.418	FFAR2_RAT Free fatty acid receptor 2 OS=Rattus norvegicus OX=10116 GN=Ffar2 PE=1 SV=1
8	O15552	6.93e-69	220	330	0.390	0.409	FFAR2_HUMAN Free fatty acid receptor 2 OS=Homo sapiens OX=9606 GN=FFAR2 PE=1 SV=1
9	P26824	8.28e-31	123	432	0.251	0.201	PAR1_RAT Proteinase-activated receptor 1 OS=Rattus norvegicus OX=10116 GN=F2r PE=2 SV=1
10	Q76JU9	8.92e-31	120	300	0.275	0.317	FFAR1_MOUSE Free fatty acid receptor 1 OS=Mus musculus OX=10090 GN=Ffar1 PE=1 SV=1
11	P32249	1.04e-29	119	361	0.246	0.235	GP183_HUMAN G-protein coupled receptor 183 OS=Homo sapiens OX=9606 GN=GPR183 PE=1 SV=3
12	Q99677	5.10e-29	117	370	0.260	0.243	LPAR4_HUMAN Lysophosphatidic acid receptor 4 OS=Homo sapiens OX=9606 GN=LPAR4 PE=1 SV=1
13	Q8BLG2	1.73e-28	115	370	0.260	0.243	LPAR4_MOUSE Lysophosphatidic acid receptor 4 OS=Mus musculus OX=10090 GN=Lpar4 PE=2 SV=2
14	Q8K3T4	3.90e-28	113	300	0.260	0.300	FFAR1_RAT Free fatty acid receptor 1 OS=Rattus norvegicus OX=10116 GN=Ffar1 PE=2 SV=1
15	P55085	4.54e-28	115	397	0.243	0.212	PAR2_HUMAN Proteinase-activated receptor 2 OS=Homo sapiens OX=9606 GN=F2RL1 PE=1 SV=1
16	Q3U6B2	4.67e-28	114	357	0.254	0.246	GP183_MOUSE G-protein coupled receptor 183 OS=Mus musculus OX=10090 GN=Gpr183 PE=1 SV=1
17	P30558	7.48e-28	114	430	0.251	0.202	PAR1_MOUSE Proteinase-activated receptor 1 OS=Mus musculus OX=10090 GN=F2r PE=1 SV=2
18	A0A0N4STT7	1.08e-27	113	351	0.286	0.282	A0A0N4STT7_DANRE Lysophosphatidic acid receptor 4 OS=Danio rerio OX=7955 GN=lpar4 PE=3 SV=1
19	A2BIP6	1.18e-27	114	413	0.234	0.196	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
20	P25116	2.42e-27	113	425	0.263	0.214	PAR1_HUMAN Proteinase-activated receptor 1 OS=Homo sapiens OX=9606 GN=F2R PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.2e-31	119.5	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	9.9	17.0	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF10328 7TM_GPCR_Srx	0.0028	28.9	Serpentine type 7TM GPCR chemoreceptor Srx
4	PF19857 DUF6332	9.6e+02	11.7	Family of unknown function (DUF6332)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328230

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360538	0.876	Free fatty acid receptor 4
2	9606.ENSP00000353198	0.837	Peptide YY
3	9606.ENSP00000450310	0.794	G-protein coupled receptor 84
4	9606.ENSP00000085219	0.767	B-cell receptor CD22
5	9606.ENSP00000265643	0.767	Galanin peptides
6	9606.ENSP00000387662	0.713	Glucagon
7	9606.ENSP00000276218	0.700	Glucose-dependent insulinotropic receptor
8	9606.ENSP00000430886	0.655	G-protein coupled bile acid receptor 1
9	9606.ENSP00000445340	0.625	Sodium-coupled monocarboxylate transporter 1
10	9606.ENSP00000286548	0.578	Guanine nucleotide-binding protein G(q) subunit alpha
11	9606.ENSP00000312652	0.572	Leptin
12	9606.ENSP00000380153	0.554	Olfactory receptor 51E2
13	9606.ENSP00000380432	0.519	Insulin
14	9606.ENSP00000350005	0.518	Gastric inhibitory polypeptide
15	9606.ENSP00000379472	0.517	Cholecystokinin
16	9606.ENSP00000380155	0.511	Olfactory receptor 51E1
17	9606.ENSP00000447149	0.505	Bile acid receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.995	protein binding
GO:0008528	0.518	G protein-coupled peptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010033	0.997	response to organic substance
GO:0007165	0.997	signal transduction
GO:0007186	0.991	G protein-coupled receptor signaling pathway
GO:1901701	0.989	cellular response to oxygen-containing compound
GO:0033993	0.988	response to lipid
GO:0071310	0.988	cellular response to organic substance
GO:0071396	0.981	cellular response to lipid
GO:0071398	0.967	cellular response to fatty acid
GO:0007188	0.870	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193	0.655	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0048518	0.556	positive regulation of biological process
GO:0032501	0.549	multicellular organismal process
GO:0051239	0.439	regulation of multicellular organismal process
GO:0019222	0.398	regulation of metabolic process
GO:0060255	0.377	regulation of macromolecule metabolic process
GO:0048583	0.364	regulation of response to stimulus
GO:0048522	0.359	positive regulation of cellular process
GO:0048519	0.355	negative regulation of biological process
GO:0023051	0.347	regulation of signaling
GO:0010646	0.347	regulation of cell communication
GO:0010468	0.341	regulation of gene expression
GO:0032879	0.335	regulation of localization
GO:0001817	0.327	regulation of cytokine production
GO:0051240	0.323	positive regulation of multicellular organismal process
GO:0010604	0.323	positive regulation of macromolecule metabolic process
GO:0065008	0.310	regulation of biological quality
GO:0048523	0.306	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]