StarFunc result for job id O14862

User Input

>input (343 residues)
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHVKPEQKQMVAQQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14862	1.000	1.000	2.215E-64	343	1.000	1.000	O14862.pdb.gz	AIM2_HUMAN Interferon-inducible protein AIM2 OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
2	AFDB:Q91VJ1	0.543	0.526	1.690E-42	354	0.563	0.545	Q91VJ1.pdb.gz	AIM2_MOUSE Interferon-inducible protein AIM2 OS=Mus musculus OX=10090 GN=Aim2 PE=1 SV=2
3	AFDB:P41218	0.535	0.455	7.747E-33	407	0.394	0.332	P41218.pdb.gz	MNDA_HUMAN Myeloid cell nuclear differentiation antigen OS=Homo sapiens OX=9606 GN=MNDA PE=1 SV=1
4	AFDB:Q16666	0.531	0.240	1.614E-30	785	0.385	0.168	Q16666.pdb.gz	IF16_HUMAN Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3
5	AFDB:Q8BV49	0.544	0.449	4.154E-30	420	0.359	0.293	Q8BV49.pdb.gz	IFIX_MOUSE Pyrin and HIN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyhin1 PE=1 SV=1
6	AFDB:Q8CGE8	0.540	0.462	5.188E-30	404	0.332	0.282	Q8CGE8.pdb.gz	IFI5A_MOUSE Interferon-activable protein 205-A OS=Mus musculus OX=10090 GN=Ifi205a PE=2 SV=1
7	AFDB:Q6K0P9	0.536	0.378	2.752E-29	492	0.359	0.250	Q6K0P9.pdb.gz	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
8	AFDB:O35368	0.549	0.466	4.799E-29	408	0.367	0.309	O35368.pdb.gz	IFI3_MOUSE Interferon-activable protein 203 OS=Mus musculus OX=10090 GN=Ifi203 PE=1 SV=1
9	AFDB:P0DOV2	0.529	0.300	4.799E-29	619	0.335	0.186	P0DOV2.pdb.gz	IFI4_MOUSE Interferon-activable protein 204 OS=Mus musculus OX=10090 GN=Ifi204 PE=1 SV=1
10	AFDB:D0QMC3	0.526	0.340	2.038E-28	538	0.353	0.225	D0QMC3.pdb.gz	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
11	PDB:2i0qA	0.267	0.206	1.231E-8	461	0.102	0.076	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
12	PDB:7qxbP	0.258	0.332	9.965E-7	251	0.082	0.112	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
13	PDB:7uy7A	0.180	0.118	2.712E-6	552	0.082	0.051	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
14	PDB:8d0bA	0.288	0.115	2.867E-6	1116	0.052	0.016	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
15	PDB:6w6wA	0.276	0.132	8.719E-6	905	0.058	0.022	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
16	PDB:7uy5I	0.179	0.123	1.217E-5	528	0.087	0.057	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
17	PDB:5h7qA	0.261	0.193	1.487E-4	469	0.079	0.058	5h7qA.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
18	PDB:4owwB	0.225	0.610	2.453E-4	107	0.055	0.178	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
19	PDB:6w6wC	0.188	0.199	7.459E-4	323	0.041	0.043	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
20	PDB:7u5cE	0.283	0.112	1.816E-3	1147	0.061	0.018	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14862	0.0	699	343	1.000	1.000	AIM2_HUMAN Interferon-inducible protein AIM2 OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
2	Q5T3W0	1.73e-120	346	167	0.487	1.000	Q5T3W0_HUMAN Absent in melanoma 2 (Fragment) OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
3	Q91VJ1	5.49e-114	336	354	0.563	0.545	AIM2_MOUSE Interferon-inducible protein AIM2 OS=Mus musculus OX=10090 GN=Aim2 PE=1 SV=2
4	P41218	2.59e-52	179	407	0.397	0.334	MNDA_HUMAN Myeloid cell nuclear differentiation antigen OS=Homo sapiens OX=9606 GN=MNDA PE=1 SV=1
5	Q5VUU6	2.59e-52	179	407	0.397	0.334	Q5VUU6_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=MNDA PE=2 SV=1
6	Q16666	4.52e-48	174	785	0.394	0.172	IF16_HUMAN Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3
7	Q8BV49	5.02e-48	169	420	0.283	0.231	IFIX_MOUSE Pyrin and HIN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyhin1 PE=1 SV=1
8	O35368	2.63e-45	161	408	0.376	0.316	IFI3_MOUSE Interferon-activable protein 203 OS=Mus musculus OX=10090 GN=Ifi203 PE=1 SV=1
9	Q8CGE8	6.70e-44	157	404	0.347	0.295	IFI5A_MOUSE Interferon-activable protein 205-A OS=Mus musculus OX=10090 GN=Ifi205a PE=2 SV=1
10	P0DOV2	2.75e-42	157	619	0.248	0.137	IFI4_MOUSE Interferon-activable protein 204 OS=Mus musculus OX=10090 GN=Ifi204 PE=1 SV=1
11	D0QMC3	5.09e-41	152	538	0.248	0.158	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
12	Q6K0P9	1.85e-38	144	492	0.370	0.258	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
13	Q9R002	1.23e-37	141	445	0.245	0.189	IFI2_MOUSE Interferon-activable protein 202 OS=Mus musculus OX=10090 GN=Ifi202 PE=1 SV=3
14	W6CW81	1.28e-27	106	113	0.169	0.513	PYDC5_HUMAN Pyrin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PYDC5 PE=1 SV=1
15	Q05CU9	6.71e-21	93.6	310	0.259	0.287	Q05CU9_HUMAN MNDA protein (Fragment) OS=Homo sapiens OX=9606 GN=MNDA PE=2 SV=1
16	X6RHR0	3.37e-04	42.7	150	0.111	0.253	X6RHR0_HUMAN Pyrin and HIN domain family member 1 (Fragment) OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
17	F8W6Z2	0.21	35.8	601	0.061	0.035	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
18	Q86W24	0.21	36.2	1093	0.073	0.023	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
19	J3KN39	0.24	35.8	1059	0.073	0.024	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
20	O15553	0.24	35.8	781	0.061	0.027	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11453 DUF2950	2.3e+02	12.4	Protein of unknown function (DUF2950)
2	PF02760 HIN	8.9e-68	238.8	HIN-200/IF120x domain
3	PF17831 PDH_E1_M	3.8e+02	11.8	Pyruvate dehydrogenase E1 component middle domain
4	PF02758 PYRIN	3e-14	64.2	PAAD/DAPIN/Pyrin domain
5	PF01336 tRNA_anti-codon	1.4e+02	13.9	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357112

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247470	0.999	Apoptosis-associated speck-like protein containing a CARD
2	9606.ENSP00000433138	0.999	Caspase-1
3	9606.ENSP00000337383	0.998	NACHT, LRR and PYD domains-containing protein 3
4	9606.ENSP00000385090	0.997	NLR family CARD domain-containing protein 4
5	9606.ENSP00000478516	0.990	NACHT, LRR and PYD domains-containing protein 1
6	9606.ENSP00000219596	0.976	Pyrin
7	9606.ENSP00000376849	0.975	Caspase-5
8	9606.ENSP00000371475	0.963	TP53-binding protein 1
9	9606.ENSP00000309767	0.947	NACHT, LRR and PYD domains-containing protein 6
10	9606.ENSP00000331857	0.943	NACHT, LRR and PYD domains-containing protein 9
11	9606.ENSP00000375767	0.939	Caspase recruitment domain-containing protein 8
12	9606.ENSP00000433209	0.939	Gasdermin-D
13	9606.ENSP00000225296	0.932	Putative ATP-dependent RNA helicase DHX33
14	9606.ENSP00000428657	0.865	Baculoviral IAP repeat-containing protein 1
15	9606.ENSP00000280357	0.816	Interleukin-18
16	9606.ENSP00000351273	0.804	Caspase-8
17	9606.ENSP00000388566	0.791	Caspase-4
18	9606.ENSP00000263341	0.790	Interleukin-1 beta
19	9606.ENSP00000382840	0.785	ATP-dependent RNA helicase DDX3X
20	9606.ENSP00000359339	0.778	Cyclic GMP-AMP synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003690	1.000	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0001817	0.996	regulation of cytokine production
GO:0050896	0.995	response to stimulus
GO:0048583	0.995	regulation of response to stimulus
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0010604	0.995	positive regulation of macromolecule metabolic process
GO:0032652	0.993	regulation of interleukin-1 production
GO:0002376	0.992	immune system process
GO:0001819	0.992	positive regulation of cytokine production
GO:0051247	0.991	positive regulation of protein metabolic process
GO:0043085	0.990	positive regulation of catalytic activity
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0050778	0.987	positive regulation of immune response
GO:0045088	0.987	regulation of innate immune response
GO:0042221	0.985	response to chemical
GO:0051716	0.985	cellular response to stimulus
GO:0052547	0.985	regulation of peptidase activity
GO:0032651	0.984	regulation of interleukin-1 beta production
GO:0071345	0.983	cellular response to cytokine stimulus
GO:2001056	0.980	positive regulation of cysteine-type endopeptidase activity
GO:0007165	0.978	signal transduction
GO:0051090	0.978	regulation of DNA-binding transcription factor activity
GO:0032732	0.967	positive regulation of interleukin-1 production
GO:0031349	0.960	positive regulation of defense response
GO:0032731	0.959	positive regulation of interleukin-1 beta production
GO:0002253	0.947	activation of immune response
GO:0045089	0.947	positive regulation of innate immune response
GO:0008219	0.936	cell death
GO:0007166	0.931	cell surface receptor signaling pathway
GO:0012501	0.924	programmed cell death
GO:0051091	0.874	positive regulation of DNA-binding transcription factor activity
GO:0019221	0.864	cytokine-mediated signaling pathway
GO:0044092	0.862	negative regulation of molecular function
GO:0032088	0.831	negative regulation of NF-kappaB transcription factor activity
GO:0034612	0.799	response to tumor necrosis factor
GO:0071356	0.785	cellular response to tumor necrosis factor
GO:0002218	0.771	activation of innate immune response
GO:0033209	0.696	tumor necrosis factor-mediated signaling pathway
GO:0006955	0.679	immune response
GO:0051092	0.649	positive regulation of NF-kappaB transcription factor activity
GO:0048522	0.628	positive regulation of cellular process
GO:0009605	0.625	response to external stimulus
GO:0071840	0.596	cellular component organization or biogenesis
GO:0016043	0.563	cellular component organization
GO:0006950	0.491	response to stress
GO:0051707	0.467	response to other organism
GO:0048519	0.431	negative regulation of biological process
GO:0065003	0.335	protein-containing complex assembly
GO:0048523	0.306	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0061702	0.994	inflammasome complex
GO:0005739	0.916	mitochondrion
GO:0016020	0.633	membrane
GO:0043232	0.481	intracellular non-membrane-bounded organelle
GO:0097169	0.393	AIM2 inflammasome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]