StarFunc result for job id O14867

User Input

>input (736 residues)
MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH
SRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE
SCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQ
TPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALALPSLCPKYRKFQKAFGTDRVR
TGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCDESKLAMEPEETKKDPASQCP
TEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKPLSGTDVQEKT
FGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV
AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGN
DDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRND
FQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLL
KERDHILSTLGETKQNLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEKDKSTP
DGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGG
ISDFCQQMTDKCTTDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14867	1.000	1.000	0.000	736	1.000	1.000	O14867.pdb.gz	BACH1_HUMAN Transcription regulator protein BACH1 OS=Homo sapiens OX=9606 GN=BACH1 PE=1 SV=2
2	AFDB:P97302	0.412	0.410	2.700E-87	739	0.806	0.802	P97302.pdb.gz	BACH1_MOUSE Transcription regulator protein BACH1 OS=Mus musculus OX=10090 GN=Bach1 PE=1 SV=1
3	AFDB:Q9BYV9	0.349	0.311	9.701E-37	841	0.371	0.325	Q9BYV9.pdb.gz	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
4	AFDB:P17789	0.153	0.175	2.674E-12	643	0.132	0.151	P17789.pdb.gz	TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster OX=7227 GN=ttk PE=1 SV=2
5	AFDB:Q7JN04	0.163	0.112	4.078E-12	1085	0.135	0.091	Q7JN04.pdb.gz	Q7JN04_DROME Pipsqueak protein OS=Drosophila melanogaster OX=7227 GN=psq PE=4 SV=1
6	AFDB:O43298	0.171	0.261	5.189E-12	467	0.102	0.161	O43298.pdb.gz	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
7	AFDB:Q24174	0.185	0.154	4.540E-11	904	0.155	0.126	Q24174.pdb.gz	ABRU_DROME Protein abrupt OS=Drosophila melanogaster OX=7227 GN=ab PE=1 SV=2
8	AFDB:Q8IQJ5	0.165	0.185	6.137E-11	648	0.128	0.145	Q8IQJ5.pdb.gz	Q8IQJ5_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG32121 PE=4 SV=2
9	AFDB:Q86T24	0.147	0.160	6.923E-11	672	0.122	0.134	Q86T24.pdb.gz	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
10	AFDB:Q8BN78	0.149	0.162	1.515E-10	671	0.121	0.133	Q8BN78.pdb.gz	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
11	PDB:6wcqC	0.148	0.760	4.579E-7	130	0.045	0.254	6wcqC.pdb.gz
12	PDB:7mk2A	0.142	0.281	4.404E-4	354	0.034	0.071	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:7f3fA	0.109	0.165	1.636E-2	460	0.026	0.041	7f3fA.pdb.gz
14	PDB:7phhA	0.112	0.196	1.636E-2	396	0.026	0.048	7phhA.pdb.gz
15	PDB:7sszA	0.100	0.185	3.804E-2	362	0.024	0.050	7sszA.pdb.gz
16	PDB:7w6sB	0.111	0.173	6.949E-2	448	0.023	0.038	7w6sB.pdb.gz
17	PDB:6sgaFS	0.090	0.220	7.839E-2	277	0.026	0.069	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:7sizB	0.099	0.201	1.060E-1	334	0.019	0.042	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
19	PDB:3lutB	0.100	0.175	1.615E-1	390	0.019	0.036	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
20	PDB:2a79B	0.095	0.235	1.822E-1	259	0.022	0.062	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14867	0.0	1509	736	1.000	1.000	BACH1_HUMAN Transcription regulator protein BACH1 OS=Homo sapiens OX=9606 GN=BACH1 PE=1 SV=2
2	P97302	0.0	1193	739	0.807	0.804	BACH1_MOUSE Transcription regulator protein BACH1 OS=Mus musculus OX=10090 GN=Bach1 PE=1 SV=1
3	P97303	2.71e-49	188	839	0.156	0.137	BACH2_MOUSE Transcription regulator protein BACH2 OS=Mus musculus OX=10090 GN=Bach2 PE=1 SV=3
4	Q9BYV9	2.60e-47	182	841	0.107	0.094	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
5	Q502I2	2.00e-38	142	162	0.090	0.407	Q502I2_DANRE BTB and CNC homology 1, basic leucine zipper transcription factor 1 OS=Danio rerio OX=7955 GN=bach1 PE=2 SV=1
6	J3QKY3	1.42e-20	98.6	573	0.065	0.084	J3QKY3_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
7	B4DYE1	1.73e-20	98.6	584	0.065	0.082	B4DYE1_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
8	F5H1B7	2.29e-20	98.2	616	0.065	0.078	F5H1B7_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
9	J9JIE5	2.55e-20	98.6	761	0.065	0.063	J9JIE5_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
10	Q61985	2.75e-20	98.2	741	0.065	0.065	NF2L1_MOUSE Endoplasmic reticulum membrane sensor NFE2L1 OS=Mus musculus OX=10090 GN=Nfe2l1 PE=1 SV=2
11	Q8JIM1	2.83e-20	97.8	586	0.064	0.080	Q8JIM1_DANRE Nuclear factor erythroid 2-related factor 2 OS=Danio rerio OX=7955 GN=nrf2 PE=2 SV=1
12	Q14494	2.88e-20	98.2	772	0.065	0.062	NF2L1_HUMAN Endoplasmic reticulum membrane sensor NFE2L1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
13	Q8NCP5	3.85e-20	97.4	570	0.094	0.121	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
14	Q16621	5.75e-20	94.7	373	0.062	0.123	NFE2_HUMAN Transcription factor NF-E2 45 kDa subunit OS=Homo sapiens OX=9606 GN=NFE2 PE=1 SV=1
15	Q07279	1.21e-19	94.0	373	0.062	0.123	NFE2_MOUSE Transcription factor NF-E2 45 kDa subunit OS=Mus musculus OX=10090 GN=Nfe2 PE=1 SV=1
16	Q8N143	5.18e-18	90.1	479	0.058	0.090	BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens OX=9606 GN=BCL6B PE=2 SV=2
17	A8KA13	5.21e-18	90.1	480	0.058	0.090	A8KA13_HUMAN B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a OS=Homo sapiens OX=9606 GN=BCL6B PE=1 SV=1
18	O88282	9.48e-18	89.0	474	0.058	0.091	BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus OX=10090 GN=Bcl6b PE=1 SV=1
19	Q86UZ6	1.20e-17	89.4	589	0.061	0.076	ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2
20	Q8BID6	3.44e-17	88.2	600	0.060	0.073	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	4.3e-21	86.6	BTB/POZ domain
2	PF00170 bZIP_1	1e-06	40.0	bZIP transcription factor
3	PF07716 bZIP_2	0.00032	32.0	Basic region leucine zipper
4	PF03131 bZIP_Maf	1.7e-11	55.8	bZIP Maf transcription factor
5	PF14197 Cep57_CLD_2	19	16.8	Centrosome localisation domain of PPC89

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418960	0.952	Breast cancer type 1 susceptibility protein
2	9606.ENSP00000260810	0.948	DNA topoisomerase 2-binding protein 1
3	9606.ENSP00000327048	0.946	Transcription factor Maf
4	9606.ENSP00000344903	0.927	Transcription factor MafK
5	9606.ENSP00000260947	0.904	BRCA1-associated RING domain protein 1
6	9606.ENSP00000350369	0.889	Transcription factor MafG
7	9606.ENSP00000377492	0.871	Hyaluronan mediated motility receptor
8	9606.ENSP00000437464	0.821	F-box/LRR-repeat protein 17
9	9606.ENSP00000345393	0.807	Transcription factor MafF
10	9606.ENSP00000269305	0.729	Cellular tumor antigen p53
11	9606.ENSP00000384863	0.715	Exportin-1
12	9606.ENSP00000307833	0.683	F-box only protein 22
13	9606.ENSP00000350359	0.667	Cyclic AMP-responsive element-binding protein 5
14	9606.ENSP00000399465	0.657	Cyclic AMP-dependent transcription factor ATF-7
15	9606.ENSP00000362410	0.629	Transcription factor MafB
16	9606.ENSP00000362649	0.540	Histone deacetylase 1
17	9606.ENSP00000216117	0.522	Heme oxygenase 1
18	9606.ENSP00000481110	0.504	Protein FAM83D
19	9606.ENSP00000268099	0.502	Secretory carrier-associated membrane protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677	0.988	DNA binding
GO:0043565	0.982	sequence-specific DNA binding
GO:0003690	0.980	double-stranded DNA binding
GO:1990837	0.972	sequence-specific double-stranded DNA binding
GO:0001067	0.965	transcription regulatory region nucleic acid binding
GO:0000976	0.960	transcription cis-regulatory region binding
GO:0000977	0.939	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.879	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.848	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.433	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0009987	0.986	cellular process
GO:0008152	0.977	metabolic process
GO:0044237	0.972	cellular metabolic process
GO:0071704	0.960	organic substance metabolic process
GO:0048519	0.957	negative regulation of biological process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0044238	0.946	primary metabolic process
GO:0048523	0.938	negative regulation of cellular process
GO:0009892	0.924	negative regulation of metabolic process
GO:0043170	0.923	macromolecule metabolic process
GO:0000122	0.897	negative regulation of transcription by RNA polymerase II
GO:0050896	0.828	response to stimulus
GO:0051716	0.811	cellular response to stimulus
GO:0006950	0.810	response to stress
GO:0034641	0.796	cellular nitrogen compound metabolic process
GO:0044260	0.789	cellular macromolecule metabolic process
GO:0046483	0.778	heterocycle metabolic process
GO:0006725	0.777	cellular aromatic compound metabolic process
GO:1901360	0.776	organic cyclic compound metabolic process
GO:0048518	0.734	positive regulation of biological process
GO:0033554	0.702	cellular response to stress
GO:0006139	0.683	nucleobase-containing compound metabolic process
GO:0048522	0.677	positive regulation of cellular process
GO:0090304	0.491	nucleic acid metabolic process
GO:0010604	0.474	positive regulation of macromolecule metabolic process
GO:0051173	0.453	positive regulation of nitrogen compound metabolic process
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0031328	0.438	positive regulation of cellular biosynthetic process
GO:0051254	0.435	positive regulation of RNA metabolic process
GO:0045893	0.434	positive regulation of DNA-templated transcription
GO:0045944	0.364	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0005829	0.964	cytosol
GO:0140513	0.898	nuclear protein-containing complex
GO:0005667	0.895	transcription regulator complex
GO:0090575	0.868	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]