StarFunc result for job id O14874

User Input

>input (412 residues)
MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAID
AAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQS
GPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZA9	0.900	0.900	1.190E-64	412	1.000	1.000	A0A024QZA9.pdb.gz
2	PDB:1gkzA	0.744	0.968	1.302E-45	316	0.757	0.987	1gkzA.pdb.gz	Structure of Rat Bckd Kinase: Nucleotide-Induced Domain Communication in a Mitochondrial Protein Kinase.
3	AFDB:O82423	0.775	0.876	6.966E-29	363	0.294	0.333	O82423.pdb.gz	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
4	AFDB:O82424	0.783	0.883	1.306E-28	364	0.301	0.341	O82424.pdb.gz	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
5	AFDB:Q9SBJ1	0.776	0.871	3.968E-28	366	0.289	0.325	Q9SBJ1.pdb.gz	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
6	AFDB:Q15118	0.748	0.708	5.762E-26	436	0.291	0.275	Q15118.pdb.gz	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
7	AFDB:Q15119	0.766	0.774	4.180E-25	407	0.262	0.265	Q15119.pdb.gz	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
8	AFDB:B5DFI9	0.747	0.742	6.778E-25	415	0.252	0.251	B5DFI9.pdb.gz
9	AFDB:O54937	0.743	0.743	8.631E-25	412	0.248	0.248	O54937.pdb.gz	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
10	AFDB:Q9P6P9	0.750	0.727	9.978E-25	425	0.277	0.268	Q9P6P9.pdb.gz	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
11	AFDB:F1NLP2	0.747	0.754	1.099E-24	408	0.255	0.257	F1NLP2.pdb.gz	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
12	PDB:2q8gA	0.709	0.789	2.064E-24	368	0.257	0.288	2q8gA.pdb.gz	Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
13	PDB:1y8pA	0.727	0.784	3.870E-24	381	0.255	0.276	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
14	PDB:3d2rB	0.724	0.819	1.121E-23	362	0.243	0.276	3d2rB.pdb.gz	Pyruvate Dehydrogenase Kinase-4 Structures Reveal a Metastable Open Conformation Fostering Robust Core-free Basal Activity.
15	PDB:3crlB	0.721	0.773	1.731E-23	383	0.250	0.269	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
16	PDB:7ebgA	0.684	0.831	2.721E-22	337	0.226	0.276	7ebgA.pdb.gz	Fragment-based lead discovery to identify novel inhibitors that target the ATP binding site of pyruvate dehydrogenase kinases.
17	PDB:5j71A	0.682	0.825	3.302E-22	338	0.235	0.287	5j71A.pdb.gz	Development of Dihydroxyphenyl Sulfonylisoindoline Derivatives as Liver-Targeting Pyruvate Dehydrogenase Kinase Inhibitors.
18	PDB:2pnrB	0.688	0.825	6.298E-21	341	0.233	0.282	2pnrB.pdb.gz	Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
19	PDB:6s1kA	0.269	0.287	1.826E-6	383	0.095	0.102	6s1kA.pdb.gz
20	PDB:7rzwB	0.274	0.144	7.546E-5	864	0.092	0.044	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14874	0.0	846	412	1.000	1.000	BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDK PE=1 SV=2
2	O55028	0.0	808	412	0.951	0.951	BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus OX=10090 GN=Bckdk PE=1 SV=1
3	Q00972	0.0	810	412	0.956	0.956	BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bckdk PE=1 SV=2
4	Q9SBJ1	1.29e-68	223	366	0.291	0.328	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
5	O82424	2.13e-68	223	364	0.296	0.335	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
6	O82423	3.20e-67	219	363	0.296	0.336	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
7	Q9JK42	2.35e-47	169	407	0.267	0.270	PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus OX=10090 GN=Pdk2 PE=1 SV=2
8	Q64536	3.05e-47	168	407	0.269	0.273	PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk2 PE=1 SV=1
9	Q63065	1.85e-46	167	434	0.265	0.251	PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk1 PE=1 SV=1
10	Q15119	2.42e-46	166	407	0.267	0.270	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
11	Q8BFP9	2.55e-46	166	434	0.265	0.251	PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdk1 PE=1 SV=2
12	O54937	2.27e-45	163	412	0.248	0.248	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
13	Q9P6P9	3.47e-45	163	425	0.284	0.275	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
14	Q15118	5.53e-45	163	436	0.277	0.261	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
15	Q16654	3.94e-44	160	411	0.245	0.246	PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens OX=9606 GN=PDK4 PE=1 SV=1
16	O70571	1.05e-43	159	412	0.245	0.245	PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus OX=10090 GN=Pdk4 PE=1 SV=1
17	F1NLP2	7.46e-43	157	408	0.260	0.262	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
18	Q922H2	5.62e-42	154	415	0.245	0.243	PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus OX=10090 GN=Pdk3 PE=1 SV=1
19	Q15120	5.84e-42	154	406	0.243	0.246	PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1
20	Q02332	5.50e-41	151	401	0.260	0.267	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10436 BCDHK_Adom3	1.5e-37	140.5	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
2	PF02518 HATPase_c	5e-10	51.2	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	0.32	22.4	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269980	0.974	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
2	9606.ENSP00000318351	0.960	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
3	9606.ENSP00000359151	0.937	Dihydrolipoamide branched chain transacylase E2
4	9606.ENSP00000205402	0.933	Dihydrolipoyl dehydrogenase, mitochondrial
5	9606.ENSP00000477341	0.845	Protein phosphatase 1K, mitochondrial
6	9606.ENSP00000378669	0.794	Fructose-bisphosphate aldolase A
7	9606.ENSP00000322991	0.695	Branched-chain-amino-acid aminotransferase, mitochondrial
8	9606.ENSP00000377446	0.684	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
9	9606.ENSP00000319730	0.668	Prostasin
10	9606.ENSP00000335304	0.658	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
11	9606.ENSP00000346643	0.654	Putative hexokinase HKDC1
12	9606.ENSP00000428259	0.651	Centrin-3
13	9606.ENSP00000298910	0.602	Leucine-rich repeat serine/threonine-protein kinase 2
14	9606.ENSP00000465039	0.592	Mitogen-activated protein kinase kinase kinase kinase 1
15	9606.ENSP00000222673	0.591	2-oxoglutarate dehydrogenase, mitochondrial
16	9606.ENSP00000367923	0.584	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
17	9606.ENSP00000419325	0.574	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
18	9606.ENSP00000406037	0.569	Histone acetyltransferase KAT8
19	9606.ENSP00000263035	0.566	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
20	9606.ENSP00000301458	0.566	CD320 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004672	0.999	protein kinase activity
GO:0005515	0.996	protein binding
GO:0005524	0.979	ATP binding
GO:0004740	0.689	pyruvate dehydrogenase (acetyl-transferring) kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901575	0.997	organic substance catabolic process
GO:0044282	0.997	small molecule catabolic process
GO:0009081	0.997	branched-chain amino acid metabolic process
GO:0009083	0.971	branched-chain amino acid catabolic process
GO:0006796	0.964	phosphate-containing compound metabolic process
GO:0065007	0.695	biological regulation
GO:0050789	0.635	regulation of biological process
GO:0050794	0.608	regulation of cellular process
GO:0019222	0.500	regulation of metabolic process
GO:0031323	0.462	regulation of cellular metabolic process
GO:0016310	0.440	phosphorylation
GO:0051171	0.420	regulation of nitrogen compound metabolic process
GO:0080090	0.388	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.989	intracellular organelle lumen
GO:0032991	0.916	protein-containing complex
GO:0005759	0.800	mitochondrial matrix
GO:1902494	0.550	catalytic complex
GO:1990204	0.544	oxidoreductase complex
GO:0098798	0.503	mitochondrial protein-containing complex
GO:0045240	0.447	dihydrolipoyl dehydrogenase complex
GO:0030062	0.446	mitochondrial tricarboxylic acid cycle enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
RHEA:23052	0.689	ATP + L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = ADP + H(+) + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit]
EC:2.7.11.2	0.689	[pyruvate dehydrogenase (acetyl-transferring)] kinase.

[back to server]