StarFunc result for job id O14879

User Input

>input (490 residues)
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYI
KHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKV
KQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAM
YHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQ
TDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA
SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQS
HQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPR
ELLSNSEQLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14879	1.000	1.000	2.201E-59	490	1.000	1.000	O14879.pdb.gz	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
2	AFDB:Q8IZ03	0.704	0.712	1.117E-28	484	0.535	0.541	Q8IZ03.pdb.gz	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
3	AFDB:Q64345	0.623	0.749	3.467E-28	403	0.490	0.596	Q64345.pdb.gz	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
4	AFDB:Q64112	0.687	0.712	3.937E-26	472	0.453	0.470	Q64112.pdb.gz	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
5	AFDB:Q13325	0.730	0.741	8.516E-25	482	0.404	0.411	Q13325.pdb.gz	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
6	AFDB:Q5T764	0.694	0.715	8.867E-25	474	0.424	0.439	Q5T764.pdb.gz	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
7	PDB:4horA	0.738	0.749	1.702E-24	482	0.402	0.409	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
8	PDB:4g1tB	0.554	0.622	2.353E-24	429	0.504	0.576	4g1tB.pdb.gz
9	AFDB:P09914	0.699	0.715	1.388E-23	478	0.412	0.423	P09914.pdb.gz	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
10	PDB:5udkA	0.691	0.731	1.190E-22	461	0.404	0.430	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
11	PDB:5w5iC	0.640	0.713	8.292E-22	436	0.392	0.440	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
12	AFDB:Q64282	0.696	0.732	8.971E-21	463	0.351	0.371	Q64282.pdb.gz	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
13	AFDB:E7FBH4	0.688	0.699	6.529E-19	482	0.294	0.299	E7FBH4.pdb.gz	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
14	AFDB:A0A068FR04	0.621	0.693	1.372E-13	433	0.216	0.245	A0A068FR04.pdb.gz	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
15	PDB:7ntfA	0.391	0.232	7.368E-7	918	0.163	0.087	7ntfA.pdb.gz
16	PDB:4bujB	0.342	0.150	2.582E-6	1367	0.139	0.050	4bujB.pdb.gz
17	PDB:7qe7J	0.361	0.349	6.815E-6	510	0.118	0.114	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:6xt9D	0.226	0.266	1.063E-5	396	0.137	0.169	6xt9D.pdb.gz
19	PDB:8a3tH	0.350	0.341	1.530E-5	505	0.124	0.121	8a3tH.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:7dkhI	0.247	0.149	2.388E-5	914	0.141	0.075	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14879	0.0	1014	490	1.000	1.000	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
2	Q5T765	0.0	1014	490	1.000	1.000	Q5T765_HUMAN Interferon-induced protein with tetratricopeptide repeats 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=IFIT3 PE=2 SV=1
3	Q64345	9.58e-175	498	403	0.496	0.603	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
4	P09913	6.45e-166	479	472	0.553	0.574	IFIT2_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=1
5	Q8IZ03	2.35e-165	478	484	0.553	0.560	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
6	Q64112	6.75e-139	410	472	0.469	0.487	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
7	Q5T764	3.67e-132	393	474	0.445	0.460	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
8	Q13325	1.99e-125	376	482	0.416	0.423	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
9	P09914	1.76e-120	363	478	0.427	0.437	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
10	Q64282	5.67e-95	297	463	0.355	0.376	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
11	E7FBH4	1.51e-64	218	482	0.314	0.320	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
12	A0A068FR04	6.97e-28	117	433	0.227	0.256	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
13	Q8CGY8	5.62e-07	54.7	1046	0.137	0.064	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
14	P56558	5.70e-07	54.7	1036	0.137	0.065	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
15	P81436	5.97e-07	54.7	1046	0.137	0.064	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
16	O15294	6.12e-07	54.7	1046	0.137	0.064	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
17	Q5GA10	1.11e-06	53.9	1036	0.135	0.064	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
18	Q5GA12	1.21e-06	53.5	1052	0.135	0.063	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
19	Q5GA13	1.25e-06	53.5	1062	0.135	0.062	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
20	Q5GA11	1.27e-06	53.5	1046	0.135	0.063	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	52	15.5	Anaphase-promoting complex, cyclosome, subunit 3
2	PF09295 ChAPs	52	14.3	ChAPs (Chs5p-Arf1p-binding proteins)
3	PF10345 Cohesin_load	0.64	20.0	Cohesin loading factor
4	PF12569 NatA_aux_su	0.12	22.9	N-terminal acetyltransferase A, auxiliary subunit
5	PF10602 RPN7	1.4e+02	13.6	26S proteasome subunit RPN7
6	PF20308 TPR-S	2.4	20.1	Tetratricopeptide Repeats-Sensor
7	PF00515 TPR_1	1.3e-10	51.9	Tetratricopeptide repeat
8	PF13374 TPR_10	14	17.0	Tetratricopeptide repeat
9	PF13414 TPR_11	6.3e-10	49.9	TPR repeat
10	PF13424 TPR_12	2.5e-10	51.8	Tetratricopeptide repeat
11	PF13428 TPR_14	8.4e-09	46.5	Tetratricopeptide repeat
12	PF13429 TPR_15	0.037	25.0	Tetratricopeptide repeat
13	PF13432 TPR_16	5.8e-05	34.9	Tetratricopeptide repeat
14	PF13431 TPR_17	2e-09	48.2	Tetratricopeptide repeat
15	PF14559 TPR_19	6.8e-11	53.8	Tetratricopeptide repeat
16	PF07719 TPR_2	4.2e-17	71.8	Tetratricopeptide repeat
17	PF07720 TPR_3	1.7e+02	13.6	Tetratricopeptide repeat
18	PF07721 TPR_4	26	16.8	Tetratricopeptide repeat
19	PF13174 TPR_6	0.0025	29.5	Tetratricopeptide repeat
20	PF13176 TPR_7	6e-07	40.1	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360883

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360869	0.999	Interferon-induced protein with tetratricopeptide repeats 1
2	9606.ENSP00000360891	0.998	Interferon-induced protein with tetratricopeptide repeats 2
3	9606.ENSP00000368699	0.996	Ubiquitin-like protein ISG15
4	9606.ENSP00000371471	0.996	Radical S-adenosyl methionine domain-containing protein 2
5	9606.ENSP00000228928	0.995	2'-5'-oligoadenylate synthase 3
6	9606.ENSP00000257570	0.995	2'-5'-oligoadenylate synthase-like protein
7	9606.ENSP00000342278	0.995	2'-5'-oligoadenylate synthase 2
8	9606.ENSP00000380697	0.995	Interferon regulatory factor 7
9	9606.ENSP00000381601	0.995	Interferon-induced GTP-binding protein Mx1
10	9606.ENSP00000388001	0.993	2'-5'-oligoadenylate synthase 1
11	9606.ENSP00000342513	0.992	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
12	9606.ENSP00000354394	0.992	Signal transducer and activator of transcription 1-alpha/beta
13	9606.ENSP00000395590	0.992	Interferon-induced 35 kDa protein
14	9606.ENSP00000333657	0.989	Interferon-induced GTP-binding protein Mx2
15	9606.ENSP00000354822	0.988	XIAP-associated factor 1
16	9606.ENSP00000380073	0.987	Interferon regulatory factor 9
17	9606.ENSP00000360860	0.979	Interferon-induced protein with tetratricopeptide repeats 5
18	9606.ENSP00000386187	0.977	Interferon-induced transmembrane protein 1
19	9606.ENSP00000315768	0.974	Signal transducer and activator of transcription 2
20	9606.ENSP00000306565	0.971	Interferon-stimulated gene 20 kDa protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.996	identical protein binding
GO:1901363	0.630	heterocyclic compound binding
GO:0097159	0.630	organic cyclic compound binding
GO:0003676	0.596	nucleic acid binding
GO:0003824	0.442	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044419	0.995	biological process involved in interspecies interaction between organisms
GO:0009607	0.995	response to biotic stimulus
GO:0009605	0.995	response to external stimulus
GO:0009615	0.992	response to virus
GO:0050794	0.991	regulation of cellular process
GO:0048519	0.991	negative regulation of biological process
GO:0042981	0.938	regulation of apoptotic process
GO:0048523	0.843	negative regulation of cellular process
GO:0009987	0.786	cellular process
GO:0042127	0.775	regulation of cell population proliferation
GO:0008285	0.645	negative regulation of cell population proliferation
GO:0060548	0.622	negative regulation of cell death
GO:0043069	0.592	negative regulation of programmed cell death
GO:0043066	0.485	negative regulation of apoptotic process
GO:0048518	0.467	positive regulation of biological process
GO:0051716	0.439	cellular response to stimulus
GO:0006950	0.429	response to stress
GO:0048522	0.419	positive regulation of cellular process
GO:0006952	0.392	defense response
GO:0098542	0.334	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.902	mitochondrion
GO:0012505	0.678	endomembrane system
GO:0005634	0.394	nucleus
GO:0070013	0.314	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]