StarFunc result for job id O14896

User Input

>input (467 residues)
MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAW
AVETGKYQEGVDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQ
GSIINPGSTGSAPWDEKDNDVDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGN
CSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQT
MTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDR
GLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLETFLSDLIAHQK
GQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR
LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G0Z349	0.451	0.451	7.347E-86	467	1.000	1.000	G0Z349.pdb.gz	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
2	AFDB:Q6PGZ7	0.539	0.514	2.510E-65	492	0.677	0.642	Q6PGZ7.pdb.gz	Q6PGZ7_DANRE Interferon regulatory factor 6 OS=Danio rerio OX=7955 GN=zgc:63500 PE=1 SV=1
3	AFDB:Q13568	0.423	0.399	1.503E-53	498	0.514	0.482	Q13568.pdb.gz	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
4	AFDB:A0A0G2JUR2	0.417	0.410	6.938E-52	475	0.503	0.495	A0A0G2JUR2.pdb.gz	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
5	AFDB:Q15306	0.354	0.366	7.786E-34	451	0.315	0.326	Q15306.pdb.gz	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
6	AFDB:A8B8L1	0.404	0.409	1.986E-31	460	0.274	0.278	A8B8L1.pdb.gz
7	AFDB:D2SR00	0.371	0.381	1.305E-29	455	0.263	0.270	D2SR00.pdb.gz	D2SR00_SALSA Interferon regulatory factor 7B OS=Salmo salar OX=8030 GN=IRF-7B PE=2 SV=1
8	AFDB:Q5NUI4	0.380	0.416	1.653E-29	424	0.287	0.316	Q5NUI4.pdb.gz
9	AFDB:M9RSF4	0.351	0.337	1.753E-29	487	0.272	0.261	M9RSF4.pdb.gz	M9RSF4_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=1
10	AFDB:P70434	0.350	0.357	9.134E-29	457	0.266	0.271	P70434.pdb.gz	IRF7_MOUSE Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1
11	PDB:4cclB	0.080	0.094	4.028E-1	372	0.071	0.089	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
12	PDB:3wvzA	0.100	0.183	5.100E-1	192	0.051	0.125	3wvzA.pdb.gz
13	PDB:6q7iA	0.067	0.049	5.100E-1	770	0.028	0.017	6q7iA.pdb.gz	Dynamic and Functional Profiling of Xylan-Degrading Enzymes inAspergillusSecretomes Using Activity-Based Probes.
14	PDB:6ulgN	0.060	0.058	5.100E-1	483	0.047	0.046	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
15	PDB:5cd4F	0.054	0.063	7.705E-1	363	0.043	0.055	5cd4F.pdb.gz	Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
16	PDB:6u7aD	0.060	0.064	9.754E-1	429	0.030	0.033	6u7aD.pdb.gz	Aspartate aminotransferase Rv3722c governs aspartate-dependent nitrogen metabolism in Mycobacterium tuberculosis.
17	PDB:2byoA	0.096	0.175	1.097	183	0.034	0.087	2byoA.pdb.gz	Lppx is a Lipoprotein Required for the Translocation of Phthiocerol Dimycocerosates to the Surface of Mycobacterium Tuberculosis.
18	PDB:7a6hP	0.126	0.311	1.097	146	0.026	0.082	7a6hP.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
19	PDB:5fm6A	0.071	0.076	1.164	426	0.058	0.063	5fm6A.pdb.gz	The Combination of X-Ray Crystallography and Cryo-Electron Microscopy Provides Insight Into the Overall Architecture of the Dodecameric Rvb1/Rvb2 Complex.
20	PDB:7myjD	0.098	0.184	1.310	187	0.036	0.091	7myjD.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AJU4	0.0	577	276	0.591	1.000	B1AJU4_HUMAN Interferon regulatory factor 6 (Fragment) OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
2	G0Z349	0.0	964	467	1.000	1.000	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
3	O14896	0.0	964	467	1.000	1.000	IRF6_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
4	P97431	0.0	947	467	0.976	0.976	IRF6_MOUSE Interferon regulatory factor 6 OS=Mus musculus OX=10090 GN=Irf6 PE=1 SV=2
5	Q6PGZ7	0.0	611	492	0.690	0.654	Q6PGZ7_DANRE Interferon regulatory factor 6 OS=Danio rerio OX=7955 GN=zgc:63500 PE=1 SV=1
6	P56477	3.96e-150	439	497	0.529	0.497	IRF5_MOUSE Interferon regulatory factor 5 OS=Mus musculus OX=10090 GN=Irf5 PE=1 SV=1
7	A0A8I5YBA0	1.07e-148	436	536	0.527	0.459	A0A8I5YBA0_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
8	A0A0G2JUR2	1.31e-148	436	528	0.527	0.466	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
9	D3ZPU1	3.00e-148	434	497	0.522	0.491	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
10	Q13568	7.64e-91	286	498	0.308	0.289	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
11	Q15306	1.24e-65	219	451	0.315	0.326	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
12	Q64287	9.79e-65	217	450	0.315	0.327	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
13	Q02556	1.53e-60	206	426	0.304	0.333	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
14	A0A8I6AJP7	2.21e-59	204	466	0.298	0.298	A0A8I6AJP7_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
15	P23611	9.50e-57	196	424	0.285	0.314	IRF8_MOUSE Interferon regulatory factor 8 OS=Mus musculus OX=10090 GN=Irf8 PE=1 SV=1
16	Q6DHK7	8.68e-51	179	423	0.287	0.317	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
17	H3BT31	8.09e-49	172	328	0.251	0.357	H3BT31_HUMAN Interferon regulatory factor 8 (Fragment) OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=1
18	F1QNG2	1.62e-47	171	422	0.281	0.310	F1QNG2_DANRE Interferon regulatory factor 7 OS=Danio rerio OX=7955 GN=wu:fl24c03 PE=4 SV=1
19	H0WFC4	6.16e-45	163	377	0.276	0.342	H0WFC4_DANRE Interferon regulatory factor 7 OS=Danio rerio OX=7955 GN=wu:fl24c03 PE=4 SV=1
20	Q14653	4.42e-43	159	427	0.283	0.309	IRF3_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	1.1e-34	130.1	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	1.1e-65	232.2	Interferon-regulatory factor 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002406

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007007	0.705	RELA proto-oncogene, NF-kB subunit
2	61853.ENSNLEP00000023521	0.704	Interferon regulatory factor 2
3	61853.ENSNLEP00000010685	0.701	Serpin family B member 5
4	61853.ENSNLEP00000015443	0.689	Interferon regulatory factor 1
5	61853.ENSNLEP00000010299	0.686	Interferon regulatory factor 7
6	61853.ENSNLEP00000010529	0.677	MX dynamin-like GTPase 2
7	61853.ENSNLEP00000010573	0.677	Uncharacterized protein
8	61853.ENSNLEP00000004188	0.673	Belongs to the acetyltransferase family. GCN5 subfamily.
9	61853.ENSNLEP00000011912	0.672	CREB binding protein
10	61853.ENSNLEP00000000873	0.668	High mobility group box 1
11	61853.ENSNLEP00000022842	0.663	Interferon, beta 1, fibroblast
12	61853.ENSNLEP00000010617	0.660	Receptor-interacting serine-threonine kinase 4
13	61853.ENSNLEP00000010850	0.660	Grainyhead-like 3 (Drosophila)
14	61853.ENSNLEP00000012925	0.660	Interferon regulatory factor 4
15	61853.ENSNLEP00000015162	0.652	Interferon regulatory factor 5
16	61853.ENSNLEP00000011915	0.651	Nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
17	61853.ENSNLEP00000013397	0.645	Rho GTPase activating protein 29
18	61853.ENSNLEP00000006381	0.643	Uncharacterized protein
19	61853.ENSNLEP00000017965	0.642	Jun proto-oncogene, AP-1 transcription factor subunit
20	61853.ENSNLEP00000000408	0.641	General transcription factor IIIA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	1.000	DNA binding
GO:0000981	0.994	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.993	sequence-specific DNA binding
GO:0003690	0.988	double-stranded DNA binding
GO:1990837	0.981	sequence-specific double-stranded DNA binding
GO:0001216	0.969	DNA-binding transcription activator activity
GO:0000976	0.861	transcription cis-regulatory region binding
GO:0001228	0.625	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.501	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042802	0.325	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0010468	0.986	regulation of gene expression
GO:0009893	0.986	positive regulation of metabolic process
GO:0009987	0.983	cellular process
GO:0048523	0.982	negative regulation of cellular process
GO:0045944	0.973	positive regulation of transcription by RNA polymerase II
GO:0042127	0.966	regulation of cell population proliferation
GO:0050896	0.825	response to stimulus
GO:0008285	0.679	negative regulation of cell population proliferation
GO:0032502	0.526	developmental process
GO:0048856	0.518	anatomical structure development
GO:0044419	0.429	biological process involved in interspecies interaction between organisms
GO:0009607	0.422	response to biotic stimulus
GO:0051716	0.409	cellular response to stimulus
GO:0009605	0.400	response to external stimulus
GO:0051707	0.392	response to other organism
GO:0032501	0.373	multicellular organismal process
GO:0042221	0.340	response to chemical
GO:0006950	0.339	response to stress
GO:0007154	0.309	cell communication
GO:0010033	0.300	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.996	nucleoplasm
GO:0030054	0.772	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]