StarFunc result for job id O14901

User Input

>input (512 residues)
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQR
SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTR
TPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTG
ESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGG
LLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMA
AGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTK
KIPGWQAEVGKLNRIASAESPGSPLVSMPASA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14901	1.000	1.000	2.943E-77	512	1.000	1.000	O14901.pdb.gz	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
2	AFDB:Q8K1S5	0.282	0.287	1.629E-53	502	0.754	0.769	Q8K1S5.pdb.gz	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
3	AFDB:P11161	0.175	0.187	1.827E-10	476	0.213	0.229	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
4	AFDB:Q01714	0.186	0.123	9.708E-10	786	0.254	0.165	Q01714.pdb.gz	SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus OX=10116 GN=Sp1 PE=1 SV=2
5	AFDB:P21192	0.173	0.119	1.189E-8	770	0.197	0.131	P21192.pdb.gz	ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACE2 PE=1 SV=1
6	AFDB:Q09838	0.155	0.117	2.571E-8	681	0.184	0.138	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
7	AFDB:Q923B3	0.152	0.100	3.780E-8	828	0.172	0.106	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
8	AFDB:Q96T25	0.164	0.128	7.185E-8	663	0.211	0.163	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
9	AFDB:M9NEG1	0.160	0.079	3.149E-7	1109	0.174	0.080	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
10	AFDB:A0A5K4F1D0	0.155	0.035	4.630E-7	2566	0.180	0.036	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
11	PDB:5c8dE	0.042	0.064	1.641	280	0.027	0.050	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
12	PDB:7dvqM	0.055	0.119	2.925	191	0.045	0.120	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:2lgvA	0.048	0.137	3.547	100	0.031	0.160	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
14	PDB:1zl9A	0.068	0.133	4.033	207	0.031	0.077	1zl9A.pdb.gz	Crystal structure of a major nematode C.elegans specific GST (CE01613)
15	PDB:7pmkQ	0.050	0.039	4.300	766	0.029	0.020	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:7od1A	0.049	0.054	4.586	430	0.023	0.028	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:4l9xB	0.045	0.050	5.560	458	0.014	0.015	4l9xB.pdb.gz
18	PDB:6a2wA	0.068	0.150	5.929	166	0.021	0.066	6a2wA.pdb.gz	Structural basis for blue-green light harvesting and energy dissipation in diatoms.
19	PDB:6yxxAI	0.039	0.065	6.323	240	0.031	0.067	6yxxAI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
20	PDB:3efpB	0.071	0.146	6.742	208	0.035	0.087	3efpB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PTS6	0.0	739	501	0.746	0.762	E9PTS6_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=4 SV=1
2	O14901	0.0	1045	512	1.000	1.000	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
3	Q309C9	0.0	740	501	0.746	0.762	Q309C9_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=2 SV=1
4	Q53QU8	0.0	1045	512	1.000	1.000	Q53QU8_HUMAN Uncharacterized protein TIEG2 OS=Homo sapiens OX=9606 GN=TIEG2 PE=2 SV=1
5	Q8K1S5	0.0	756	502	0.752	0.767	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
6	O08876	2.16e-90	286	480	0.365	0.390	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
7	Q13118	1.05e-89	285	480	0.393	0.419	KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens OX=9606 GN=KLF10 PE=1 SV=1
8	O89091	3.14e-85	273	479	0.371	0.397	KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus OX=10090 GN=Klf10 PE=1 SV=1
9	Q8IPV7	2.75e-42	156	347	0.166	0.245	Q8IPV7_DROME Cabut, isoform B OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
10	Q95R58	2.75e-42	156	347	0.166	0.245	Q95R58_DROME SD05726p OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
11	Q9Y2Y9	6.21e-42	153	288	0.137	0.243	KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens OX=9606 GN=KLF13 PE=1 SV=1
12	Q9JJZ6	6.37e-42	153	289	0.137	0.242	KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus OX=10090 GN=Klf13 PE=1 SV=2
13	Q9VPQ5	7.81e-42	157	428	0.166	0.199	Q9VPQ5_DROME Cabut, isoform A OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=2
14	Q4R0P9	9.18e-42	156	428	0.139	0.166	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
15	P58334	2.29e-40	148	251	0.129	0.263	KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus OX=10090 GN=Klf16 PE=1 SV=2
16	A8E7A9	9.60e-40	146	250	0.131	0.268	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
17	Q9BXK1	2.14e-39	145	252	0.121	0.246	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
18	P08047	4.27e-39	154	785	0.127	0.083	SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3
19	Q01714	6.13e-39	153	786	0.127	0.083	SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus OX=10116 GN=Sp1 PE=1 SV=2
20	O89090	1.34e-38	152	784	0.125	0.082	SP1_MOUSE Transcription factor Sp1 OS=Mus musculus OX=10090 GN=Sp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19126 DUF5810	2.5e+02	13.2	Family of unknown function (DUF5810)
2	PF16159 FOXP-CC	10	18.0	FOXP coiled-coil domain
3	PF00096 zf-C2H2	6.3e-11	53.2	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	3.2e-05	35.4	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	75	14.8	C2H2-type zinc finger
6	PF15909 zf-C2H2_8	0.37	22.5	C2H2-type zinc ribbon
7	PF05605 zf-Di19	29	16.4	Drought induced 19 protein (Di19), zinc-binding
8	PF13465 zf-H2C2_2	2.1e-10	51.7	Zinc-finger double domain
9	PF12874 zf-met	31	16.4	Zinc-finger of C2H2 type
10	PF18408 zf_Hakai	64	14.7	C2H2 Hakai zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378402	0.995	Paired amphipathic helix protein Sin3a
2	9606.ENSP00000332973	0.829	Mothers against decapentaplegic homolog 3
3	9606.ENSP00000263253	0.633	Histone acetyltransferase p300
4	9606.ENSP00000209875	0.601	Chromobox protein homolog 5
5	9606.ENSP00000357175	0.597	ETS translocation variant 3
6	9606.ENSP00000344479	0.596	Nuclear receptor subfamily 4 group A member 2
7	9606.ENSP00000365380	0.595	Forkhead box protein P3
8	9606.ENSP00000341843	0.585	Transcription factor ETV7
9	9606.ENSP00000320089	0.583	Homeobox protein Nkx-2.6
10	9606.ENSP00000345147	0.575	Homeobox protein Nkx-2.4
11	9606.ENSP00000384524	0.574	ETS translocation variant 2
12	9606.ENSP00000339906	0.572	Paired box protein Pax-4
13	9606.ENSP00000430241	0.571	Transcription factor COE2
14	9606.ENSP00000259089	0.568	Tyrosine-protein kinase Blk
15	9606.ENSP00000354206	0.563	Zinc finger protein 219
16	9606.ENSP00000362649	0.546	Histone deacetylase 1
17	9606.ENSP00000346886	0.531	GA-binding protein alpha chain
18	9606.ENSP00000215832	0.529	Mitogen-activated protein kinase 1
19	9606.ENSP00000379658	0.525	Transcription factor ETV6
20	9606.ENSP00000229239	0.512	Glyceraldehyde-3-phosphate dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.494	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.970	regulation of DNA-templated transcription
GO:0048519	0.920	negative regulation of biological process
GO:0048523	0.892	negative regulation of cellular process
GO:0009890	0.891	negative regulation of biosynthetic process
GO:0010605	0.890	negative regulation of macromolecule metabolic process
GO:0048518	0.879	positive regulation of biological process
GO:0006357	0.877	regulation of transcription by RNA polymerase II
GO:0048522	0.872	positive regulation of cellular process
GO:0031327	0.870	negative regulation of cellular biosynthetic process
GO:0045934	0.854	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.830	negative regulation of RNA metabolic process
GO:0010558	0.824	negative regulation of macromolecule biosynthetic process
GO:0045892	0.806	negative regulation of DNA-templated transcription
GO:0000122	0.707	negative regulation of transcription by RNA polymerase II
GO:0009893	0.648	positive regulation of metabolic process
GO:0050896	0.588	response to stimulus
GO:0009891	0.545	positive regulation of biosynthetic process
GO:0031328	0.543	positive regulation of cellular biosynthetic process
GO:0010604	0.524	positive regulation of macromolecule metabolic process
GO:0051173	0.508	positive regulation of nitrogen compound metabolic process
GO:0010557	0.484	positive regulation of macromolecule biosynthetic process
GO:0045935	0.438	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.405	positive regulation of RNA biosynthetic process
GO:0045893	0.400	positive regulation of DNA-templated transcription
GO:0051716	0.380	cellular response to stimulus
GO:0045944	0.331	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.994	cytosol
GO:0030055	0.540	cell-substrate junction
GO:0016604	0.513	nuclear body
GO:0005925	0.412	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]