StarFunc result for job id O14904

User Input

>input (365 residues)
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14904	1.000	1.000	2.364E-67	365	1.000	1.000	O14904.pdb.gz	WNT9A_HUMAN Protein Wnt-9a OS=Homo sapiens OX=9606 GN=WNT9A PE=1 SV=2
2	AFDB:Q3L251	0.845	0.849	1.037E-49	363	0.808	0.813	Q3L251.pdb.gz	Q3L251_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT9a PE=2 SV=1
3	AFDB:B6V3E1	0.866	0.871	2.907E-48	363	0.734	0.738	B6V3E1.pdb.gz	B6V3E1_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
4	AFDB:O35468	0.820	0.834	1.409E-39	359	0.586	0.596	O35468.pdb.gz	WNT9B_MOUSE Protein Wnt-9b OS=Mus musculus OX=10090 GN=Wnt9b PE=2 SV=2
5	AFDB:Q0P406	0.645	0.716	6.378E-39	327	0.663	0.740	Q0P406.pdb.gz	Q0P406_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
6	AFDB:Q3L250	0.757	0.854	6.572E-37	322	0.562	0.637	Q3L250.pdb.gz	Q3L250_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT9b PE=2 SV=1
7	AFDB:P24257	0.784	0.775	2.482E-29	370	0.356	0.351	P24257.pdb.gz	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
8	AFDB:Q91029	0.818	0.811	6.338E-29	368	0.359	0.356	Q91029.pdb.gz	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
9	AFDB:P10108	0.756	0.744	6.677E-29	371	0.345	0.340	P10108.pdb.gz	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
10	AFDB:P70701	0.711	0.627	7.410E-29	417	0.381	0.333	P70701.pdb.gz	WN10A_MOUSE Protein Wnt-10a OS=Mus musculus OX=10090 GN=Wnt10a PE=2 SV=1
11	PDB:6ahyB	0.671	0.774	3.935E-23	313	0.301	0.351	6ahyB.pdb.gz
12	PDB:4f0aB	0.618	0.754	9.329E-21	294	0.279	0.347	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7c7sA	0.129	0.086	1.077	685	0.033	0.018	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
14	PDB:6sb3A	0.054	0.036	1.910	604	0.014	0.008	6sb3A.pdb.gz
15	PDB:7f8xA	0.111	0.096	2.352	443	0.049	0.041	7f8xA.pdb.gz	Structures of the human cholecystokinin receptors bound to agonists and antagonists.
16	PDB:7kd4A	0.079	0.069	2.750	431	0.044	0.037	7kd4A.pdb.gz	Structural Analysis of the Menangle Virus P Protein Reveals a Soft Boundary between Ordered and Disordered Regions.
17	PDB:7kgbR	0.052	0.127	2.750	100	0.016	0.060	7kgbR.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
18	PDB:7x3kB	0.079	0.061	2.750	506	0.030	0.022	7x3kB.pdb.gz
19	PDB:7x9bR	0.116	0.133	3.215	302	0.052	0.063	7x9bR.pdb.gz
20	PDB:3b07B	0.080	0.102	3.387	270	0.000	0.000	3b07B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6V3E1	0.0	579	363	0.756	0.760	B6V3E1_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
2	O14904	0.0	749	365	1.000	1.000	WNT9A_HUMAN Protein Wnt-9a OS=Homo sapiens OX=9606 GN=WNT9A PE=1 SV=2
3	O42280	0.0	609	354	0.797	0.822	WNT9A_CHICK Protein Wnt-9a OS=Gallus gallus OX=9031 GN=WNT9A PE=2 SV=1
4	Q3L251	0.0	629	363	0.830	0.835	Q3L251_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT9a PE=2 SV=1
5	Q8R5M2	0.0	736	365	0.981	0.981	WNT9A_MOUSE Protein Wnt-9a OS=Mus musculus OX=10090 GN=Wnt9a PE=2 SV=1
6	Q0P406	2.82e-174	489	327	0.666	0.743	Q0P406_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
7	Q3L250	1.56e-154	439	322	0.573	0.649	Q3L250_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT9b PE=2 SV=1
8	O14905	3.38e-151	432	357	0.581	0.594	WNT9B_HUMAN Protein Wnt-9b OS=Homo sapiens OX=9606 GN=WNT9B PE=1 SV=3
9	O35468	3.46e-149	427	359	0.589	0.599	WNT9B_MOUSE Protein Wnt-9b OS=Mus musculus OX=10090 GN=Wnt9b PE=2 SV=2
10	Q3C2H6	2.04e-74	236	353	0.337	0.348	Q3C2H6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=Wnt6 PE=2 SV=1
11	Q92048	2.28e-70	226	350	0.345	0.360	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
12	P24257	2.49e-70	226	370	0.326	0.322	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
13	P10108	2.04e-69	224	371	0.318	0.313	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
14	P04426	3.04e-69	223	370	0.334	0.330	WNT1_MOUSE Proto-oncogene Wnt-1 OS=Mus musculus OX=10090 GN=Wnt1 PE=1 SV=1
15	P04628	3.17e-69	223	370	0.334	0.330	WNT1_HUMAN Proto-oncogene Wnt-1 OS=Homo sapiens OX=9606 GN=WNT1 PE=1 SV=1
16	D4A9J2	3.98e-69	223	370	0.334	0.330	D4A9J2_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt1 PE=3 SV=1
17	Q91029	8.24e-69	222	368	0.329	0.326	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
18	P56706	3.29e-68	220	349	0.337	0.352	WNT7B_HUMAN Protein Wnt-7b OS=Homo sapiens OX=9606 GN=WNT7B PE=1 SV=2
19	Q98SN7	3.54e-68	221	385	0.337	0.319	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
20	Q3L254	4.55e-68	219	349	0.326	0.341	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	5.6e-94	326.7	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294304	0.979	Low-density lipoprotein receptor-related protein 5
2	9606.ENSP00000261349	0.975	Low-density lipoprotein receptor-related protein 6
3	9606.ENSP00000322304	0.961	Protein-serine O-palmitoleoyltransferase porcupine
4	9606.ENSP00000346829	0.930	Protein wntless homolog
5	9606.ENSP00000284523	0.924	Protein Wnt-3a
6	9606.ENSP00000380379	0.923	Protein Wnt-5b
7	9606.ENSP00000225512	0.922	Proto-oncogene Wnt-3
8	9606.ENSP00000264634	0.922	Protein Wnt-5a
9	9606.ENSP00000290167	0.922	Protein Wnt-4
10	9606.ENSP00000358698	0.922	Protein Wnt-2b
11	9606.ENSP00000265441	0.920	Protein Wnt-2
12	9606.ENSP00000293549	0.920	Proto-oncogene Wnt-1
13	9606.ENSP00000426653	0.915	Protein Wnt-8a
14	9606.ENSP00000325526	0.914	Protein Wnt-11
15	9606.ENSP00000222462	0.913	Protein Wnt-16
16	9606.ENSP00000233948	0.913	Protein Wnt-6
17	9606.ENSP00000301061	0.913	Protein Wnt-10b
18	9606.ENSP00000258411	0.912	Protein Wnt-10a
19	9606.ENSP00000340677	0.912	Protein Wnt-8b
20	9606.ENSP00000341032	0.911	Protein Wnt-7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0048018	0.989	receptor ligand activity
GO:0005109	0.301	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0048856	0.980	anatomical structure development
GO:0198738	0.976	cell-cell signaling by wnt
GO:0051716	0.975	cellular response to stimulus
GO:0016055	0.968	Wnt signaling pathway
GO:0032501	0.964	multicellular organismal process
GO:0048518	0.929	positive regulation of biological process
GO:0007275	0.909	multicellular organism development
GO:0060070	0.903	canonical Wnt signaling pathway
GO:0048731	0.850	system development
GO:0048523	0.849	negative regulation of cellular process
GO:0048522	0.848	positive regulation of cellular process
GO:0019222	0.839	regulation of metabolic process
GO:0060255	0.793	regulation of macromolecule metabolic process
GO:0080090	0.771	regulation of primary metabolic process
GO:0051171	0.771	regulation of nitrogen compound metabolic process
GO:0048513	0.766	animal organ development
GO:0009653	0.677	anatomical structure morphogenesis
GO:0031323	0.633	regulation of cellular metabolic process
GO:0009888	0.619	tissue development
GO:0050793	0.617	regulation of developmental process
GO:0009893	0.601	positive regulation of metabolic process
GO:0030154	0.575	cell differentiation
GO:0023051	0.569	regulation of signaling
GO:0010646	0.568	regulation of cell communication
GO:0010468	0.560	regulation of gene expression
GO:0010604	0.553	positive regulation of macromolecule metabolic process
GO:0048583	0.547	regulation of response to stimulus
GO:0042127	0.524	regulation of cell population proliferation
GO:0009966	0.497	regulation of signal transduction
GO:0051239	0.443	regulation of multicellular organismal process
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0045595	0.374	regulation of cell differentiation
GO:0010556	0.352	regulation of macromolecule biosynthetic process
GO:0031326	0.352	regulation of cellular biosynthetic process
GO:0051252	0.341	regulation of RNA metabolic process
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0051093	0.335	negative regulation of developmental process
GO:0009892	0.333	negative regulation of metabolic process
GO:0031325	0.329	positive regulation of cellular metabolic process
GO:0009887	0.328	animal organ morphogenesis
GO:2001141	0.325	regulation of RNA biosynthetic process
GO:0006355	0.319	regulation of DNA-templated transcription
GO:0009967	0.310	positive regulation of signal transduction
GO:0065009	0.309	regulation of molecular function
GO:0051094	0.304	positive regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.724	intracellular anatomical structure
GO:0005737	0.629	cytoplasm
GO:0043226	0.400	organelle
GO:0071944	0.396	cell periphery
GO:0016020	0.351	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]