StarFunc result for job id O14905

User Input

>input (357 residues)
MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKL
SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLY
AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
RGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
RYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35468	0.919	0.914	3.693E-61	359	0.927	0.922	O35468.pdb.gz	WNT9B_MOUSE Protein Wnt-9b OS=Mus musculus OX=10090 GN=Wnt9b PE=2 SV=2
2	AFDB:Q3L250	0.845	0.935	6.253E-49	322	0.714	0.792	Q3L250.pdb.gz	Q3L250_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT9b PE=2 SV=1
3	AFDB:Q3L251	0.831	0.818	5.117E-42	363	0.588	0.579	Q3L251.pdb.gz	Q3L251_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT9a PE=2 SV=1
4	AFDB:B6V3E1	0.810	0.797	1.231E-41	363	0.594	0.584	B6V3E1.pdb.gz	B6V3E1_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
5	AFDB:O14904	0.826	0.808	6.751E-41	365	0.588	0.575	O14904.pdb.gz	WNT9A_HUMAN Protein Wnt-9a OS=Homo sapiens OX=9606 GN=WNT9A PE=1 SV=2
6	AFDB:Q0P406	0.639	0.696	1.401E-34	327	0.521	0.569	Q0P406.pdb.gz	Q0P406_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
7	AFDB:Q91029	0.783	0.761	3.782E-32	368	0.342	0.332	Q91029.pdb.gz	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
8	AFDB:P24257	0.777	0.751	8.155E-32	370	0.353	0.341	P24257.pdb.gz	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
9	AFDB:P40589	0.725	0.488	1.665E-31	539	0.378	0.250	P40589.pdb.gz	WNT4_DROME Protein Wnt-4 OS=Drosophila melanogaster OX=7227 GN=Wnt4 PE=2 SV=2
10	AFDB:Q92048	0.767	0.781	2.314E-31	350	0.370	0.377	Q92048.pdb.gz	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
11	PDB:6ahyB	0.721	0.817	1.866E-26	313	0.303	0.345	6ahyB.pdb.gz
12	PDB:4f0aB	0.655	0.784	2.343E-23	294	0.286	0.347	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:7c7sA	0.136	0.091	5.075E-1	685	0.056	0.029	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
14	PDB:3j6bN	0.057	0.115	8.787E-1	118	0.025	0.076	3j6bN.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:6sb3A	0.079	0.049	1.363	604	0.011	0.007	6sb3A.pdb.gz
16	PDB:3b07B	0.083	0.105	1.521	270	0.008	0.011	3b07B.pdb.gz
17	PDB:5apnP	0.061	0.104	1.521	183	0.017	0.033	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:7pzyx	0.065	0.118	1.794	172	0.014	0.029	7pzyx.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
19	PDB:8a1dA	0.065	0.047	2.360	533	0.020	0.013	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
20	PDB:4v8mA2	0.092	0.151	2.634	187	0.064	0.123	4v8mA2.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14905	0.0	728	357	1.000	1.000	WNT9B_HUMAN Protein Wnt-9b OS=Homo sapiens OX=9606 GN=WNT9B PE=1 SV=3
2	O35468	0.0	627	359	0.874	0.869	WNT9B_MOUSE Protein Wnt-9b OS=Mus musculus OX=10090 GN=Wnt9b PE=2 SV=2
3	Q3L250	0.0	535	322	0.717	0.795	Q3L250_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT9b PE=2 SV=1
4	Q3L251	1.70e-155	442	363	0.599	0.590	Q3L251_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT9a PE=2 SV=1
5	B6V3E1	4.22e-155	442	363	0.585	0.576	B6V3E1_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
6	O42280	9.60e-155	440	354	0.585	0.590	WNT9A_CHICK Protein Wnt-9a OS=Gallus gallus OX=9031 GN=WNT9A PE=2 SV=1
7	O14904	4.56e-153	437	365	0.611	0.597	WNT9A_HUMAN Protein Wnt-9a OS=Homo sapiens OX=9606 GN=WNT9A PE=1 SV=2
8	Q8R5M2	3.81e-151	432	365	0.605	0.592	WNT9A_MOUSE Protein Wnt-9a OS=Mus musculus OX=10090 GN=Wnt9a PE=2 SV=1
9	Q0P406	6.01e-130	376	327	0.521	0.569	Q0P406_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=zgc:153617 PE=2 SV=1
10	Q9UBV4	6.63e-75	237	365	0.406	0.397	WNT16_HUMAN Protein Wnt-16 OS=Homo sapiens OX=9606 GN=WNT16 PE=2 SV=1
11	P10108	6.04e-74	235	371	0.339	0.326	WNT1_XENLA Protein Wnt-1 OS=Xenopus laevis OX=8355 GN=wnt1 PE=2 SV=1
12	Q9QYS1	4.30e-73	233	364	0.403	0.396	WNT16_MOUSE Protein Wnt-16 OS=Mus musculus OX=10090 GN=Wnt16 PE=2 SV=2
13	Q92048	1.81e-72	231	350	0.361	0.369	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
14	P47793	4.74e-72	229	352	0.339	0.344	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
15	P56705	1.91e-71	228	351	0.381	0.387	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
16	O70283	2.13e-71	229	389	0.373	0.342	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
17	P24257	2.74e-71	228	370	0.356	0.343	WNT1_DANRE Protein Wnt-1 OS=Danio rerio OX=7955 GN=wnt1 PE=2 SV=1
18	Q93097	3.65e-71	229	391	0.373	0.340	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
19	Q91029	4.02e-71	228	368	0.350	0.340	WNT1_CHICK Protein Wnt-1 OS=Gallus gallus OX=9031 GN=WNT1 PE=1 SV=3
20	Q9QXQ5	5.48e-71	227	351	0.381	0.387	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	3.2e-92	321.0	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322304	0.961	Protein-serine O-palmitoleoyltransferase porcupine
2	9606.ENSP00000294304	0.954	Low-density lipoprotein receptor-related protein 5
3	9606.ENSP00000346829	0.948	Protein wntless homolog
4	9606.ENSP00000261349	0.934	Low-density lipoprotein receptor-related protein 6
5	9606.ENSP00000225512	0.924	Proto-oncogene Wnt-3
6	9606.ENSP00000284523	0.924	Protein Wnt-3a
7	9606.ENSP00000290167	0.922	Protein Wnt-4
8	9606.ENSP00000380379	0.922	Protein Wnt-5b
9	9606.ENSP00000264634	0.921	Protein Wnt-5a
10	9606.ENSP00000265441	0.920	Protein Wnt-2
11	9606.ENSP00000358698	0.920	Protein Wnt-2b
12	9606.ENSP00000293549	0.919	Proto-oncogene Wnt-1
13	9606.ENSP00000325526	0.914	Protein Wnt-11
14	9606.ENSP00000233948	0.913	Protein Wnt-6
15	9606.ENSP00000258411	0.912	Protein Wnt-10a
16	9606.ENSP00000426653	0.912	Protein Wnt-8a
17	9606.ENSP00000301061	0.911	Protein Wnt-10b
18	9606.ENSP00000340677	0.911	Protein Wnt-8b
19	9606.ENSP00000222462	0.909	Protein Wnt-16
20	9606.ENSP00000341032	0.909	Protein Wnt-7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0048018	0.987	receptor ligand activity
GO:0005109	0.444	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0007165	0.995	signal transduction
GO:0007275	0.992	multicellular organism development
GO:0007166	0.992	cell surface receptor signaling pathway
GO:0007267	0.990	cell-cell signaling
GO:0048731	0.981	system development
GO:0198738	0.980	cell-cell signaling by wnt
GO:0016055	0.970	Wnt signaling pathway
GO:0048513	0.965	animal organ development
GO:0060070	0.958	canonical Wnt signaling pathway
GO:0050793	0.945	regulation of developmental process
GO:0048518	0.875	positive regulation of biological process
GO:0019222	0.862	regulation of metabolic process
GO:0048522	0.849	positive regulation of cellular process
GO:0060255	0.808	regulation of macromolecule metabolic process
GO:0048519	0.800	negative regulation of biological process
GO:0051171	0.785	regulation of nitrogen compound metabolic process
GO:0080090	0.784	regulation of primary metabolic process
GO:0031323	0.742	regulation of cellular metabolic process
GO:0035567	0.732	non-canonical Wnt signaling pathway
GO:0009653	0.728	anatomical structure morphogenesis
GO:0048523	0.671	negative regulation of cellular process
GO:0009893	0.669	positive regulation of metabolic process
GO:0010604	0.659	positive regulation of macromolecule metabolic process
GO:0009888	0.658	tissue development
GO:0010468	0.649	regulation of gene expression
GO:0030154	0.637	cell differentiation
GO:0051239	0.630	regulation of multicellular organismal process
GO:0010556	0.469	regulation of macromolecule biosynthetic process
GO:0031326	0.447	regulation of cellular biosynthetic process
GO:0019219	0.429	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.418	regulation of RNA biosynthetic process
GO:0006355	0.413	regulation of DNA-templated transcription
GO:0031325	0.396	positive regulation of cellular metabolic process
GO:0048583	0.385	regulation of response to stimulus
GO:0051173	0.372	positive regulation of nitrogen compound metabolic process
GO:0009966	0.359	regulation of signal transduction
GO:0007399	0.356	nervous system development
GO:0009891	0.320	positive regulation of biosynthetic process
GO:0010557	0.312	positive regulation of macromolecule biosynthetic process
GO:0045595	0.309	regulation of cell differentiation
GO:0031328	0.307	positive regulation of cellular biosynthetic process
GO:0042127	0.305	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.931	cell periphery
GO:0016020	0.904	membrane
GO:0043227	0.877	membrane-bounded organelle
GO:0005886	0.859	plasma membrane
GO:0043229	0.847	intracellular organelle
GO:0043231	0.830	intracellular membrane-bounded organelle
GO:0032991	0.820	protein-containing complex
GO:0005737	0.732	cytoplasm
GO:0012505	0.475	endomembrane system
GO:0043233	0.326	organelle lumen
GO:0070013	0.317	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]