StarFunc result for job id O14908

User Input

>input (333 residues)
MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVF
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLE
DFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEA
INGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
GTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDEL
AEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14908	1.000	1.000	1.958E-66	333	1.000	1.000	O14908.pdb.gz	GIPC1_HUMAN PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2
2	AFDB:Q6B337	0.884	0.879	3.128E-58	335	0.826	0.821	Q6B337.pdb.gz	Q6B337_DANRE GAIP c-terminus interacting protein 1 OS=Danio rerio OX=7955 GN=GIPC PE=1 SV=1
3	AFDB:Q7ZV93	0.851	0.864	4.567E-54	328	0.697	0.707	Q7ZV93.pdb.gz	Q7ZV93_DANRE GAIP c-terminus interacting protein 2 OS=Danio rerio OX=7955 GN=gipc1 PE=2 SV=1
4	AFDB:Q5HZ83	0.850	0.855	1.302E-52	331	0.697	0.701	Q5HZ83.pdb.gz	Q5HZ83_XENLA GIPC PDZ domain containing family member 2 S homeolog OS=Xenopus laevis OX=8355 GN=gipc2.S PE=1 SV=1
5	AFDB:Q9Z2H7	0.803	0.851	2.538E-48	314	0.610	0.646	Q9Z2H7.pdb.gz	GIPC2_MOUSE PDZ domain-containing protein GIPC2 OS=Mus musculus OX=10090 GN=Gipc2 PE=1 SV=1
6	AFDB:Q8TF65	0.797	0.842	3.198E-48	315	0.601	0.635	Q8TF65.pdb.gz	GIPC2_HUMAN PDZ domain-containing protein GIPC2 OS=Homo sapiens OX=9606 GN=GIPC2 PE=1 SV=1
7	AFDB:Q8TF64	0.809	0.863	6.396E-48	312	0.595	0.635	Q8TF64.pdb.gz	GIPC3_HUMAN PDZ domain-containing protein GIPC3 OS=Homo sapiens OX=9606 GN=GIPC3 PE=1 SV=1
8	AFDB:Q7JX82	0.766	0.760	1.331E-42	336	0.502	0.497	Q7JX82.pdb.gz	Q7JX82_DROME GH21964p OS=Drosophila melanogaster OX=7227 GN=kermit PE=1 SV=1
9	AFDB:Q6ZPF3	0.264	0.070	2.597E-9	1715	0.165	0.032	Q6ZPF3.pdb.gz	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
10	AFDB:Q9NY99	0.242	0.155	3.139E-7	539	0.129	0.080	Q9NY99.pdb.gz	SNTG2_HUMAN Gamma-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTG2 PE=1 SV=2
11	PDB:5n7dA	0.244	0.193	3.870E-6	423	0.105	0.083	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
12	PDB:7p73A	0.227	0.181	4.100E-6	420	0.096	0.076	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7p70A	0.221	0.182	4.343E-6	407	0.111	0.091	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7qqnC	0.227	0.184	4.875E-6	414	0.096	0.077	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7pc3A	0.234	0.194	1.950E-5	405	0.096	0.079	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7qqmA	0.257	0.212	3.096E-5	413	0.108	0.087	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7pcbA	0.256	0.209	7.364E-5	415	0.090	0.072	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:2xkxA	0.225	0.106	1.653E-4	721	0.072	0.033	2xkxA.pdb.gz
19	PDB:6t36A	0.227	0.739	5.561E-4	93	0.054	0.194	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
20	PDB:7pe9I	0.225	0.235	1.323E-3	317	0.045	0.047	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O14908	0.0	666	333	1.000	1.000	GIPC1_HUMAN PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2
2	Q6B337	0.0	531	335	0.817	0.812	Q6B337_DANRE GAIP c-terminus interacting protein 1 OS=Danio rerio OX=7955 GN=GIPC PE=1 SV=1
3	Q9Z0G0	0.0	617	333	0.964	0.964	GIPC1_MOUSE PDZ domain-containing protein GIPC1 OS=Mus musculus OX=10090 GN=Gipc1 PE=1 SV=1
4	Q9Z254	0.0	645	333	0.964	0.964	GIPC1_RAT PDZ domain-containing protein GIPC1 OS=Rattus norvegicus OX=10116 GN=Gipc1 PE=1 SV=2
5	Q7ZV93	1.03e-168	474	328	0.715	0.726	Q7ZV93_DANRE GAIP c-terminus interacting protein 2 OS=Danio rerio OX=7955 GN=gipc1 PE=2 SV=1
6	Q5HZ83	9.72e-165	464	331	0.706	0.710	Q5HZ83_XENLA GIPC PDZ domain containing family member 2 S homeolog OS=Xenopus laevis OX=8355 GN=gipc2.S PE=1 SV=1
7	Q8TF65	4.40e-131	378	315	0.613	0.648	GIPC2_HUMAN PDZ domain-containing protein GIPC2 OS=Homo sapiens OX=9606 GN=GIPC2 PE=1 SV=1
8	Q8TF64	3.50e-129	373	312	0.559	0.596	GIPC3_HUMAN PDZ domain-containing protein GIPC3 OS=Homo sapiens OX=9606 GN=GIPC3 PE=1 SV=1
9	Q9Z2H7	5.68e-122	355	314	0.586	0.621	GIPC2_MOUSE PDZ domain-containing protein GIPC2 OS=Mus musculus OX=10090 GN=Gipc2 PE=1 SV=1
10	Q7JX82	2.07e-106	316	336	0.480	0.476	Q7JX82_DROME GH21964p OS=Drosophila melanogaster OX=7227 GN=kermit PE=1 SV=1
11	O15018	7.92e-06	50.1	2839	0.081	0.010	PDZD2_HUMAN PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PDZD2 PE=1 SV=4
12	Q9QZR8	1.53e-05	49.3	2766	0.081	0.010	PDZD2_RAT PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Pdzd2 PE=1 SV=1
13	F1Q897	4.69e-05	47.8	1503	0.096	0.021	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
14	Q9NB04	5.10e-04	44.3	871	0.123	0.047	PATJ_DROME Patj homolog OS=Drosophila melanogaster OX=7227 GN=Patj PE=1 SV=2
15	Q9WVQ1	0.003	42.0	1275	0.087	0.023	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
16	O88382	0.004	41.6	1277	0.087	0.023	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
17	Q86UL8	0.004	41.2	1455	0.063	0.014	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
18	A0A8I3NPD4	0.007	40.8	1398	0.069	0.016	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
19	E0CYS1	0.007	39.3	174	0.075	0.144	E0CYS1_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
20	H7C4U7	0.007	40.8	1131	0.069	0.020	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08841 DDR	3.8e+02	11.5	Diol dehydratase reactivase ATPase-like domain
2	PF00595 PDZ	0.00046	31.8	PDZ domain
3	PF17820 PDZ_6	9.4	17.5	PDZ domain
4	PF01948 PyrI	4.2e+02	12.6	Aspartate carbamoyltransferase regulatory chain, allosteric domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378483	0.999	Regulator of G-protein signaling 19
2	9606.ENSP00000361818	0.998	Syndecan-4
3	9606.ENSP00000431418	0.998	High affinity nerve growth factor receptor
4	9606.ENSP00000265371	0.996	Neuropilin-1
5	9606.ENSP00000358994	0.996	Unconventional myosin-VI
6	9606.ENSP00000288266	0.973	DCC-interacting protein 13-alpha
7	9606.ENSP00000277120	0.972	BDNF/NT-3 growth factors receptor
8	9606.ENSP00000263816	0.956	Low-density lipoprotein receptor-related protein 2
9	9606.ENSP00000439625	0.949	Pleckstrin homology domain-containing family G member 5
10	9606.ENSP00000263923	0.948	Vascular endothelial growth factor receptor 2
11	9606.ENSP00000414303	0.943	Brain-derived neurotrophic factor
12	9606.ENSP00000358765	0.938	Trophoblast glycoprotein
13	9606.ENSP00000416293	0.922	Solute carrier family 2, facilitated glucose transporter member 1
14	9606.ENSP00000268035	0.918	Insulin-like growth factor 1 receptor
15	9606.ENSP00000358525	0.917	Beta-nerve growth factor
16	9606.ENSP00000362014	0.915	Dynamin-1
17	9606.ENSP00000356056	0.908	Dynein light chain Tctex-type 1
18	9606.ENSP00000353582	0.900	Neuropilin-2
19	9606.ENSP00000373570	0.879	5,6-dihydroxyindole-2-carboxylic acid oxidase
20	9606.ENSP00000354859	0.874	D(2) dopamine receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.301	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.996	regulation of metabolic process
GO:0048522	0.987	positive regulation of cellular process
GO:0031323	0.931	regulation of cellular metabolic process
GO:0009987	0.924	cellular process
GO:0050896	0.836	response to stimulus
GO:0007154	0.802	cell communication
GO:0023052	0.800	signaling
GO:0051171	0.760	regulation of nitrogen compound metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0032501	0.725	multicellular organismal process
GO:0009893	0.711	positive regulation of metabolic process
GO:0009889	0.701	regulation of biosynthetic process
GO:0060255	0.678	regulation of macromolecule metabolic process
GO:0051716	0.618	cellular response to stimulus
GO:0048519	0.588	negative regulation of biological process
GO:0032502	0.555	developmental process
GO:0048523	0.553	negative regulation of cellular process
GO:0048856	0.552	anatomical structure development
GO:0051302	0.528	regulation of cell division
GO:0023051	0.516	regulation of signaling
GO:0043455	0.503	regulation of secondary metabolic process
GO:0007165	0.499	signal transduction
GO:0051179	0.485	localization
GO:0048583	0.480	regulation of response to stimulus
GO:0009966	0.465	regulation of signal transduction
GO:0051234	0.454	establishment of localization
GO:0007275	0.444	multicellular organism development
GO:0031325	0.390	positive regulation of cellular metabolic process
GO:0048731	0.348	system development
GO:0071840	0.326	cellular component organization or biogenesis
GO:0051726	0.313	regulation of cell cycle
GO:0010604	0.313	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.999	cell periphery
GO:0031410	0.997	cytoplasmic vesicle
GO:0012505	0.995	endomembrane system
GO:0005829	0.993	cytosol
GO:0005886	0.984	plasma membrane
GO:0005576	0.977	extracellular region
GO:0030054	0.968	cell junction
GO:0070062	0.929	extracellular exosome
GO:0031090	0.825	organelle membrane
GO:0032991	0.616	protein-containing complex
GO:0045202	0.566	synapse
GO:0005634	0.528	nucleus
GO:0098685	0.370	Schaffer collateral - CA1 synapse
GO:0030139	0.365	endocytic vesicle
GO:0099503	0.355	secretory vesicle
GO:0120025	0.330	plasma membrane bounded cell projection
GO:0043232	0.320	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]