StarFunc result for job id O14917

User Input

>input (1159 residues)
MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQPGLPPAERGGGGRSK
SGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKV
EIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFG
LDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPRSATVQINVKVIDSNDNS
PVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDPKT
GLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQGA
LSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQ
VHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSF
NFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRN
AGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVE
LVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISIILL
AAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQSEVEERNAM
NVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG
TNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADS
DQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPA
ANQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLK
AKRALSPLLQEVPSASSSPTKACIEPCTSTKGSLDGCEAKPGALAEASSQYLPTDSQYLS
PSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQLDHPNRDLGRESVDAEEVVR
EIDKLLQDCRGNDPVAVRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QME5	0.496	0.523	0.000	1094	0.439	0.465	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
2	AFDB:C4P342	0.578	0.589	0.000	1137	0.744	0.758	C4P342.pdb.gz	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
3	AFDB:O14917	1.000	1.000	0.000	1159	1.000	1.000	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
4	AFDB:A0A2R8RMH2	0.511	0.515	2.205E-99	1150	0.378	0.381	A0A2R8RMH2.pdb.gz
5	AFDB:F1QRP2	0.517	0.527	4.236E-99	1135	0.374	0.381	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
6	AFDB:Q9HCL0	0.520	0.530	1.279E-98	1135	0.355	0.362	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
7	AFDB:Q9BZA8	0.345	0.302	1.633E-75	1340	0.279	0.241	Q9BZA8.pdb.gz	PC11Y_HUMAN Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1
8	AFDB:Q8N6Y1	0.242	0.291	1.179E-60	951	0.204	0.248	Q8N6Y1.pdb.gz	PCD20_HUMAN Protocadherin-20 OS=Homo sapiens OX=9606 GN=PCDH20 PE=2 SV=2
9	AFDB:Q05BQ1	0.153	0.151	1.432E-19	1179	0.131	0.129	Q05BQ1.pdb.gz	TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus OX=10090 GN=Igsf9 PE=1 SV=2
10	AFDB:Q9P2J2	0.171	0.169	1.751E-19	1179	0.135	0.133	Q9P2J2.pdb.gz	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
11	PDB:7sqcO0	0.136	0.137	1.083E-14	1140	0.085	0.086	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.093	0.134	6.287E-14	721	0.067	0.108	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6velC	0.145	0.688	2.722E-12	209	0.040	0.220	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:1e07A	0.123	0.175	9.637E-11	642	0.055	0.100	1e07A.pdb.gz
15	PDB:4rtdA	0.071	0.073	1.325E-8	1122	0.062	0.064	4rtdA.pdb.gz
16	PDB:6dldD	0.104	0.304	6.953E-8	269	0.031	0.134	6dldD.pdb.gz
17	PDB:7q5zA	0.088	0.080	2.839E-7	1344	0.056	0.048	7q5zA.pdb.gz
18	PDB:6h03A	0.091	0.087	4.035E-7	1223	0.070	0.066	6h03A.pdb.gz
19	PDB:7nycA	0.091	0.074	8.153E-7	1542	0.060	0.045	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7q1yA	0.087	0.078	9.479E-7	1374	0.064	0.054	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QI99	781	997	0.382	0.444	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
2	A0A2R8QME5	918	1094	0.433	0.459	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
3	A1L1W7	923	1078	0.433	0.466	A1L1W7_DANRE Wu:fc83e05 protein (Fragment) OS=Danio rerio OX=7955 GN=wu:fc83e05 PE=2 SV=1
4	A9CPE6	650	1150	0.342	0.344	A9CPE6_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh 18 PE=2 SV=2
5	A9QUV5	672	1123	0.387	0.399	A9QUV5_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh18 PE=2 SV=1
6	C4P342	1726	1137	0.747	0.762	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
7	E9PX28	776	1047	0.388	0.430	E9PX28_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
8	E9PXF0	2338	1157	0.982	0.984	E9PXF0_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=1 SV=1
9	E9PXQ7	778	1057	0.388	0.426	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
10	F1QRP2	679	1135	0.380	0.388	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
11	F8W3X3	925	1088	0.433	0.461	PCD19_DANRE Protocadherin-19 OS=Danio rerio OX=7955 GN=pcdh19 PE=1 SV=2
12	O14917	2395	1159	1.000	1.000	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
13	Q3UTP0	1522	755	0.645	0.989	Q3UTP0_MOUSE Cadherin domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
14	Q5HZI5	2337	1157	0.981	0.983	Q5HZI5_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
15	Q6NYV7	781	1001	0.383	0.444	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
16	Q6P0A6	678	896	0.332	0.430	Q6P0A6_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
17	Q805F0	766	1026	0.380	0.429	Q805F0_DANRE Protocadherin 10 OS=Danio rerio OX=7955 GN=pcdh10 PE=2 SV=1
18	Q80TE2	778	1098	0.393	0.415	Q80TE2_MOUSE MKIAA1400 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
19	Q8VHR0	643	1134	0.363	0.371	PCD18_MOUSE Protocadherin 18 OS=Mus musculus OX=10090 GN=Pcdh18 PE=1 SV=2
20	Q925I8	778	1040	0.393	0.438	Q925I8_MOUSE OL-protocadherin isoform OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	8.6e-86	293.9	Cadherin domain
2	PF08266 Cadherin_2	1.1e-13	62.1	Cadherin-like
3	PF16184 Cadherin_3	9.9e-05	33.6	Cadherin-like
4	PF17803 Cadherin_4	1.4	20.9	Bacterial cadherin-like domain
5	PF16492 Cadherin_C_2	0.075	25.0	Cadherin cytoplasmic C-terminal
6	PF08159 NUC153	6.4e+02	11.6	NUC153 domain
7	PF03413 PepSY	2.7e+02	13.5	Peptidase propeptide and YPEB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358165	0.684	High affinity immunoglobulin gamma Fc receptor I
2	9606.ENSP00000282538	0.683	Acidic amino acid decarboxylase GADL1
3	9606.ENSP00000475473	0.675	Protein Churchill
4	9606.ENSP00000265634	0.673	Neuronal pentraxin-2
5	9606.ENSP00000269053	0.666	Sperm acrosome membrane-associated protein 3
6	9606.ENSP00000312814	0.664	BTB/POZ domain-containing protein KCTD2
7	9606.ENSP00000385968	0.658	Potassium voltage-gated channel subfamily S member 3
8	9606.ENSP00000481056	0.629	Fc fragment of IgG binding protein
9	9606.ENSP00000273590	0.624	T-cell leukemia translocation-altered gene protein
10	9606.ENSP00000326759	0.596	Leucine-rich repeats and immunoglobulin-like domains protein 3
11	9606.ENSP00000295851	0.585	Abl interactor 2
12	9606.ENSP00000378492	0.582	Metabotropic glutamate receptor 2
13	9606.ENSP00000479816	0.576	DENN domain-containing protein 1B
14	9606.ENSP00000452126	0.572	Repulsive guidance molecule A
15	9606.ENSP00000231484	0.566	Protocadherin-12
16	9606.ENSP00000304127	0.556	Potassium voltage-gated channel subfamily G member 3
17	9606.ENSP00000366283	0.531	SLIT and NTRK-like protein 5
18	9606.ENSP00000412763	0.522	MAM and LDL-receptor class A domain-containing protein 1
19	9606.ENSP00000367164	0.520	Proline rich 20A
20	9606.ENSP00000368799	0.504	Kelch repeat and BTB domain containing 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.633	ion binding
GO:0046872	0.395	metal ion binding
GO:0042802	0.344	identical protein binding
GO:0005509	0.328	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007155	0.985	cell adhesion
GO:0032501	0.977	multicellular organismal process
GO:0050794	0.970	regulation of cellular process
GO:0048856	0.948	anatomical structure development
GO:0098609	0.923	cell-cell adhesion
GO:0007275	0.920	multicellular organism development
GO:0071840	0.919	cellular component organization or biogenesis
GO:0016043	0.913	cellular component organization
GO:0034329	0.871	cell junction assembly
GO:0099172	0.855	presynapse organization
GO:0050805	0.853	negative regulation of synaptic transmission
GO:0098742	0.794	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0048731	0.781	system development
GO:0007416	0.762	synapse assembly
GO:0099054	0.741	presynapse assembly
GO:0030534	0.670	adult behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0030054	0.976	cell junction
GO:0097060	0.885	synaptic membrane
GO:0045211	0.841	postsynaptic membrane
GO:0043226	0.711	organelle
GO:0042734	0.664	presynaptic membrane
GO:0005622	0.437	intracellular anatomical structure
GO:0043229	0.372	intracellular organelle
GO:0005737	0.309	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]